BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1159 (721 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_22167| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_29864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_20858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 180 KL*THHGRKLCQDHLQKLQPRSEARSTTNP 269 +L HHGR+L +DHL PR R P Sbjct: 199 RLLKHHGRELIKDHLDLPLPRQPKRRRLPP 228 >SB_22167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1612 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Frame = +2 Query: 254 VHNQSLE*ENFLRRWCRQAY*TRQLE--VHYLVGEQQSVLQ-DPQ 379 VHN+S E +NFLR +Q ++E VH + E Q+VL DP+ Sbjct: 602 VHNESSESKNFLREDPKQTSNISEIESAVHNELSEGQNVLSLDPK 646 >SB_29864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 27.9 bits (59), Expect = 8.8 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +1 Query: 103 RRNTMEYCYKLWVGNGQEIVRKYFPLNFRLIM--AGNYVKIIYRNYNLALKLGPQPIPRM 276 R N +E +L V +GQ + R Y + + + A +V Y LKLG PI Sbjct: 158 RHNLVERQVQLTV-DGQSLERDYLLVRLQKVQLAAAGFVTKRYAGLEEVLKLGWLPITER 216 Query: 277 REFPTA 294 R+F A Sbjct: 217 RDFSLA 222 >SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2484 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 553 IVELAIVDEEQDVVFYLAGWKNHCSLVLSALLPPY 449 IVE VD+E + + Y A ++ + V ALLP Y Sbjct: 857 IVEPESVDKEVNQILYYADIRSEVAFVAPALLPQY 891 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,482,843 Number of Sequences: 59808 Number of extensions: 438785 Number of successful extensions: 1164 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -