BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1159 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 3.1 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 4.1 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.5 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 9.5 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 24.6 bits (51), Expect = 3.1 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 76 VVNNLIIDKRRNTMEYCYKLWVG-NGQEIVRKYFPL 180 ++N I+ + RN+ME+C G G +VR+ P+ Sbjct: 85 LLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 101 LSMIRLLTTFWMMEPLPWLSYS 36 L+++ +LT +W M LP+L S Sbjct: 97 LTLVEILTKYWPMGRLPFLCKS 118 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 333 FITLWENNRVYFKIHNTKYNQYLKMSTTTCNCNSRDR 443 FI+ W+ VY+ +H YN+ +S T S R Sbjct: 392 FISHWQEEGVYWSLHYL-YNRLRDISEETSALPSHPR 427 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.0 bits (47), Expect = 9.5 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -2 Query: 639 MSGRPATSPSCPTALRSPEAFTIVPSSKASLNWRL*MKNRTSFSTWRAGRT 487 +SG +SP PT SP+ K+ W MK ++ S G+T Sbjct: 165 VSGSDMSSPGAPTGSSSPQITPRPTPVKSPYEW---MKKQSYQSQPNPGKT 212 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,718 Number of Sequences: 2352 Number of extensions: 14894 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -