BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1159 (721 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058442-1|AAL13671.1| 463|Drosophila melanogaster GH22459p pro... 29 6.4 AE014296-1274|AAF50549.2| 463|Drosophila melanogaster CG4321-PA... 29 6.4 >AY058442-1|AAL13671.1| 463|Drosophila melanogaster GH22459p protein. Length = 463 Score = 29.1 bits (62), Expect = 6.4 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +3 Query: 201 RKLCQDHLQKLQPRSEARSTTNPSNERISYGDGVDKHTELVSWKFITLWENNRVYFKI 374 R +C L + + +NE Y + V++ T L+SW+F++++ + F + Sbjct: 127 RSICAAALDIIAETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELLFTL 184 >AE014296-1274|AAF50549.2| 463|Drosophila melanogaster CG4321-PA protein. Length = 463 Score = 29.1 bits (62), Expect = 6.4 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +3 Query: 201 RKLCQDHLQKLQPRSEARSTTNPSNERISYGDGVDKHTELVSWKFITLWENNRVYFKI 374 R +C L + + +NE Y + V++ T L+SW+F++++ + F + Sbjct: 127 RSICAAALDIIAETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELLFTL 184 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,184,793 Number of Sequences: 53049 Number of extensions: 651198 Number of successful extensions: 1922 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1922 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3211306956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -