BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1157 (892 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0706 + 24457148-24458031,24458621-24458822,24458896-244590... 29 6.6 03_05_0183 - 21681673-21682524 28 8.7 >01_05_0706 + 24457148-24458031,24458621-24458822,24458896-24459080, 24459170-24459503,24459614-24459818,24460022-24460128, 24460220-24460381 Length = 692 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Frame = -3 Query: 521 LAGFARLASAL----EAFRHNPADGXSHHRPLG 435 LAG RLA AL EA R +PA+G +H R G Sbjct: 259 LAGLGRLADALRDCEEAVRLDPANGRAHSRLAG 291 >03_05_0183 - 21681673-21682524 Length = 283 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +1 Query: 202 SQAFIATLLFDPSMSALPSLXXKIRQALDCSPIKRERELGLDRRETG 342 SQAF A LL D + +A+P + + R A + + + E E RR TG Sbjct: 229 SQAFSAVLLADANRAAIPVVVVQKRPAPE-TETETEEEPPRQRRRTG 274 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,633,918 Number of Sequences: 37544 Number of extensions: 404985 Number of successful extensions: 893 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -