BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1157 (892 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.3 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 24 5.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 7.1 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 424 SCTRPSGRWCEXPSAGLCL 480 SC RP G C P G C+ Sbjct: 594 SCDRPGGLLCSGPDHGRCV 612 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 24.2 bits (50), Expect = 5.4 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -3 Query: 545 SGLHSEHILAGFARLASALEAFRHNPADGXSHHRPLGRVHEPNVRNCGS 399 +GL+S HI + + + + H+P +G ++ P G + P N G+ Sbjct: 351 AGLNSSHIYTTPSSNSLSTQ-HSHSPVNGYGNNHPTGGSNLPGNNNGGA 398 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 7.1 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 498 SQPSESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRSSK 620 +QPSES K E + G +S+ S SKR+ +K Sbjct: 1563 AQPSESAKGTTRRERSKQGRKVSDQSSSQTSPSKRKDSVTK 1603 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 804,601 Number of Sequences: 2352 Number of extensions: 13594 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -