BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1157 (892 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 68 4e-11 BC034532-1|AAH34532.1| 327|Homo sapiens calcium channel, voltag... 31 7.4 AF162692-1|AAF14538.1| 327|Homo sapiens putative voltage-gated ... 31 7.4 AF142625-1|AAF03090.1| 327|Homo sapiens calcium channel gamma 4... 31 7.4 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 68.1 bits (159), Expect = 4e-11 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 254 GRADIEGSKSNVAMNAWLPQASYPCGNFSGTXC*K 150 GRADIEGSKS+VAMNAW PQASYPCGNFS T C K Sbjct: 3 GRADIEGSKSDVAMNAWPPQASYPCGNFSDTSCLK 37 >BC034532-1|AAH34532.1| 327|Homo sapiens calcium channel, voltage-dependent, gamma subunit 4 protein. Length = 327 Score = 30.7 bits (66), Expect = 7.4 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 806 GNCXRINNFTQEXSFDHDTNSEL 738 G+C RIN+F ++ +DHD++ L Sbjct: 78 GHCFRINHFPEDNDYDHDSSEYL 100 >AF162692-1|AAF14538.1| 327|Homo sapiens putative voltage-gated calcium channel gamma-4 subunit protein. Length = 327 Score = 30.7 bits (66), Expect = 7.4 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 806 GNCXRINNFTQEXSFDHDTNSEL 738 G+C RIN+F ++ +DHD++ L Sbjct: 78 GHCFRINHFPEDNDYDHDSSEYL 100 >AF142625-1|AAF03090.1| 327|Homo sapiens calcium channel gamma 4 subunit protein. Length = 327 Score = 30.7 bits (66), Expect = 7.4 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 806 GNCXRINNFTQEXSFDHDTNSEL 738 G+C RIN+F ++ +DHD++ L Sbjct: 78 GHCFRINHFPEDNDYDHDSSEYL 100 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,546,340 Number of Sequences: 237096 Number of extensions: 2181456 Number of successful extensions: 3324 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3324 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11437206932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -