BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1156 (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 4.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.9 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 9.9 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 279 RTTGRSAECMNQMSETAVPLVLSS 350 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 5.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 326 SFGHLVHALGRAAGGAKLPSAGLC*TPLRPKP 231 S LV A+ AGG PSAG P+ P P Sbjct: 393 SMSALVSAVRSPAGGQLPPSAG---APMPPIP 421 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 9.9 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 206 CSLWSPEKSGGSKQCDFTSRVSHSKRETRRRSPFGSRRSML 84 CS ++S GS ++R S RR S FGS L Sbjct: 21 CSNSQSQRSSGSSISRNSNRSESSGYCGRRPSTFGSSNEAL 61 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +3 Query: 393 LSHDGLIPAHVPF*WVNNPT 452 +SH + HVP W+ PT Sbjct: 694 VSHTQRLVVHVPPRWIVEPT 713 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 9.9 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 206 CSLWSPEKSGGSKQCDFTSRVSHSKRETRRRSPFGSRRSML 84 CS ++S GS ++R S RR S FGS L Sbjct: 21 CSNSQSQRSSGSSISRNSNRSESSGYCGRRPSTFGSSNEAL 61 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,376 Number of Sequences: 438 Number of extensions: 3690 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -