BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1155 (685 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 31 0.71 At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 30 1.2 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.8 At1g59720.1 68414.m06720 pentatricopeptide (PPR) repeat-containi... 28 5.0 At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein ... 28 6.6 At4g29310.1 68417.m04190 expressed protein 27 8.8 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -3 Query: 377 LACGSQAFIATLLFDPSMSALPIIAKQNSPSVGLFT 270 + C S + + LL P + L I+ QN P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -1 Query: 241 TVVRQVSFTLLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGL-CLNASKAEA 65 T+V+++ L+ C CD + N +H ++ +K P AGL C +A+ Sbjct: 632 TLVKKMEPDSLVHCTCDCDVRLLHENMDLASDIHRKHQSPIESKDPEAGLDCKERIQADC 691 Query: 64 SLAESGKD 41 S GK+ Sbjct: 692 SPDSGGKE 699 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 500 RAKAGLIQMFSTHRDCESTAYRSFSIK 420 RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At1g59720.1 68414.m06720 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 638 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = -1 Query: 184 TAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTLE 26 T Y S G LVH L A PSA N + SLAE+ DM L+ Sbjct: 13 TITYYHPMSIGLLVHPLSPHIPPASSPSASTAGNHHQRIFSLAETCSDMSQLK 65 >At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 718 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 679 VPSVQSGDVAENARRRLKLPRDPVRDTA 596 VPS D AE A R K+P+ PV+ +A Sbjct: 378 VPSTVDPDAAETAERGNKIPKRPVKISA 405 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +1 Query: 325 IEGSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIK 486 I G K ++ ++ + + + CG SG K+ + D A LS+++ N W K Sbjct: 85 ISGKKISLRVSVYAGRTGHTCGVASGKLLGKVEVAVDLAAALSRTVAFHNGWKK 138 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,613,498 Number of Sequences: 28952 Number of extensions: 327796 Number of successful extensions: 764 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -