Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm1150
         (564 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7R6J5 Cluster: GLP_170_144564_153311; n=2; Eukaryota|R...    33   6.1  

>UniRef50_Q7R6J5 Cluster: GLP_170_144564_153311; n=2; Eukaryota|Rep:
           GLP_170_144564_153311 - Giardia lamblia ATCC 50803
          Length = 2915

 Score = 32.7 bits (71), Expect = 6.1
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
 Frame = -2

Query: 272 RVPAQKFQTNVICHKTD*ILCHLWWYR*IVTVLNAIQILLL--*IKYIMLVNLIMEGFNY 99
           R P  K++ NV  H+   +LC +   R +++VLN+  +  L   + Y+ L+NL+    +Y
Sbjct: 416 RNPIVKYEVNVHIHERYILLCMIHVQRPVMSVLNSKTVYTLSDELNYLGLLNLLFSTLDY 475

Query: 98  YL 93
            L
Sbjct: 476 IL 477


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 481,284,815
Number of Sequences: 1657284
Number of extensions: 8522331
Number of successful extensions: 16428
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 16093
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16425
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 37904934977
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)