BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1150 (564 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0334 + 16779883-16780150,16780618-16781828 29 3.4 10_01_0242 + 2534316-2535482 28 5.9 >09_04_0334 + 16779883-16780150,16780618-16781828 Length = 492 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 325 PKDTLNRLNRTNHATSLLAFPPKSFKPMSYAIKQIKFCAIC 203 P + R TN SLL +PP + KP + + + C C Sbjct: 337 PPNAFLRFCLTNEKFSLLQYPPCNLKPTRFIEVEGELCCAC 377 >10_01_0242 + 2534316-2535482 Length = 388 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 109 PSIIKLTNIIYFIYKSNICMAFKTVTIYLYH 201 PSI+ + N+IY+ KS +AF+ T LYH Sbjct: 203 PSIL-VGNVIYWPLKSKHILAFELATSRLYH 232 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,370,128 Number of Sequences: 37544 Number of extensions: 210768 Number of successful extensions: 335 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 335 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -