Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm1150
         (564 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_35310| Best HMM Match : Cadherin (HMM E-Value=5.9e-23)              29   2.6  

>SB_35310| Best HMM Match : Cadherin (HMM E-Value=5.9e-23)
          Length = 1250

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +1

Query: 388 VKCNKAAGRNFLGSSKKFTEKISVNDHYFTEILWHPISVNSSQTI-NVAN*LASFQS 555
           VKC  + G+ F  +++KF   + + D Y   I + PISV    ++   A  L + QS
Sbjct: 382 VKCTDS-GQPFENATQKFVIYLIMYDDYHASITYRPISVKEDASVGTTAGTLTATQS 437


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,631,805
Number of Sequences: 59808
Number of extensions: 266124
Number of successful extensions: 444
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 431
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 444
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1325051197
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)