BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1150 (564 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 26 0.74 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 24 3.9 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 26.2 bits (55), Expect = 0.74 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 397 NKAAGRNFLGSSKKFTEKISVNDHYFTEILWHPISVNSS 513 N+ GRN L S K + +S ++ LW +S+ S Sbjct: 605 NEKTGRNALQSGKPIGKLVSYRTNFQESWLWKNVSIGRS 643 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.8 bits (49), Expect = 3.9 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = -3 Query: 427 IPRSYAQRLCYILPHLCTFTDIKQLINHNYYTFKPKDTLNRLNRTNHATSLLA 269 + R +R C LP + ++++ I Y+ LNR HA +L+ Sbjct: 242 VARYNVERFCNRLPAVKPLKNLREPIPEAYFPKLLNSALNRTYPGRHANMVLS 294 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 518,323 Number of Sequences: 2352 Number of extensions: 8282 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -