BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1150 (564 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66565-4|CAA91480.1| 384|Caenorhabditis elegans Hypothetical pr... 30 1.3 Z47069-1|CAA87338.1| 964|Caenorhabditis elegans Hypothetical pr... 27 9.3 >Z66565-4|CAA91480.1| 384|Caenorhabditis elegans Hypothetical protein T04F8.4 protein. Length = 384 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = -3 Query: 394 ILPHLCTFTDI----KQLINHNYYTFKPKD 317 I P +C+F D KQ++ N TFKPKD Sbjct: 275 ITPPMCSFKDANSNEKQIVKRNARTFKPKD 304 >Z47069-1|CAA87338.1| 964|Caenorhabditis elegans Hypothetical protein F36G3.1 protein. Length = 964 Score = 27.1 bits (57), Expect = 9.3 Identities = 17/61 (27%), Positives = 26/61 (42%) Frame = -3 Query: 397 YILPHLCTFTDIKQLINHNYYTFKPKDTLNRLNRTNHATSLLAFPPKSFKPMSYAIKQIK 218 Y P + TDI +INH+ T K DT+ N P++ P +KQ+ Sbjct: 33 YATPLASSLTDISNVINHS-VTIKVPDTIADANDLEPGERTPVSTPRAISPP--IVKQVM 89 Query: 217 F 215 + Sbjct: 90 Y 90 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,342,958 Number of Sequences: 27780 Number of extensions: 210628 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1166125180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -