BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1142 (668 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16770.2 68418.m01964 myb family transcription factor (MYB9) ... 31 0.92 At5g16770.1 68418.m01963 myb family transcription factor (MYB9) ... 31 0.92 At1g76965.1 68414.m08961 glycine-rich protein 29 2.1 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.7 At5g42370.1 68418.m05159 expressed protein 29 3.7 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 29 3.7 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 29 3.7 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 3.7 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 4.9 At4g21520.1 68417.m03110 transducin family protein / WD-40 repea... 28 6.5 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 6.5 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 6.5 At5g22390.1 68418.m02612 expressed protein 27 8.5 >At5g16770.2 68418.m01964 myb family transcription factor (MYB9) contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 336 Score = 30.7 bits (66), Expect = 0.92 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 2/91 (2%) Frame = -1 Query: 500 Y*NTNSLKRTLRTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLE 321 Y NT+ K+ L+ ID HRP +T H VL A P L +L+ Sbjct: 107 YWNTHLRKKLLQMGIDPVTHRP-----RTDHLNVLAALPQLIAAANFNSLLNLNQNVQLD 161 Query: 320 ALHL--GDLLRIWVRTGATSPRTSSPEFSRS 234 A L LL ++ +T+ T++P FS S Sbjct: 162 ATTLAKAQLLHTMIQVLSTNNNTTNPSFSSS 192 >At5g16770.1 68418.m01963 myb family transcription factor (MYB9) contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 336 Score = 30.7 bits (66), Expect = 0.92 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 2/91 (2%) Frame = -1 Query: 500 Y*NTNSLKRTLRTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLE 321 Y NT+ K+ L+ ID HRP +T H VL A P L +L+ Sbjct: 107 YWNTHLRKKLLQMGIDPVTHRP-----RTDHLNVLAALPQLIAAANFNSLLNLNQNVQLD 161 Query: 320 ALHL--GDLLRIWVRTGATSPRTSSPEFSRS 234 A L LL ++ +T+ T++P FS S Sbjct: 162 ATTLAKAQLLHTMIQVLSTNNNTTNPSFSSS 192 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 448 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 353 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 235 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 101 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 174 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 64 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 488 NSLKRTLRTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 363 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 488 NSLKRTLRTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 363 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +1 Query: 37 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 168 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 230 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 132 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At4g21520.1 68417.m03110 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to guanine nucleotide-binding protein beta 5 (GI:1001939) [Mesocricetus auratus] Length = 425 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 211 GGVRILSADLENSGEDVRGDVAPVRTH 291 GG+++ S + ++S +R DV+P RTH Sbjct: 12 GGLKVESGEQKSSWPTMRFDVSPYRTH 38 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 457 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 338 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 457 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 338 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 109 ERSGKSFLFCLSVRVPWNPIEG 174 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,589,680 Number of Sequences: 28952 Number of extensions: 346168 Number of successful extensions: 1057 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -