BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1141 (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0156 - 5981080-5982189,5982227-5982247,5983308-5983337 32 0.38 02_01_0410 + 2996779-2997888 32 0.38 >03_02_0156 - 5981080-5982189,5982227-5982247,5983308-5983337 Length = 386 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 236 NIKLENFSIYSLNKGYCLNVNVIVYIILYRFWECAYPVSITLL 364 NI L+ S+Y + GYCL+ +++ I + + YP ++T L Sbjct: 48 NILLQQASVYGVAAGYCLSASLLSIINKWAVMKFPYPGALTAL 90 >02_01_0410 + 2996779-2997888 Length = 369 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 236 NIKLENFSIYSLNKGYCLNVNVIVYIILYRFWECAYPVSITLL 364 NI L+ S+Y + GYCL+ +++ I + + YP ++T L Sbjct: 31 NILLQQTSVYGVAAGYCLSASLLSIINKWAVMKFPYPGALTAL 73 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,205,731 Number of Sequences: 37544 Number of extensions: 229278 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -