BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1135 (616 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 36 3e-04 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 25 0.38 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 24 0.88 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 24 0.88 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 35.9 bits (79), Expect = 3e-04 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = -1 Query: 433 QVADAVEYCHQHHVIHRDIKPENILVAFSGDLKLADFGWS 314 QVA +E+ + V+HRD+ N+LV + +K++DFG S Sbjct: 600 QVALGMEHLAKTRVVHRDLAARNVLVCENHTVKVSDFGLS 639 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 25.4 bits (53), Expect = 0.38 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 210 RYIPVTGWFHSAALSIPLL 154 RY+ + WF SA S+P+L Sbjct: 140 RYLILAAWFFSALYSLPIL 158 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 24.2 bits (50), Expect = 0.88 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 350 KSHQNIFWFYVTMYYMMLVTVFNSISYL 433 +SH NI W+ + Y + T + ++YL Sbjct: 193 ESHPNITWYQQCVTYNVFPTYAHELTYL 220 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 24.2 bits (50), Expect = 0.88 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 350 KSHQNIFWFYVTMYYMMLVTVFNSISYL 433 +SH NI W+ + Y + T + ++YL Sbjct: 193 ESHPNITWYQQCVTYNVFPTYAHELTYL 220 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,925 Number of Sequences: 336 Number of extensions: 2946 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -