BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1129 (699 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_03_0033 - 7248131-7248711,7248947-7249079,7249470-7249994,725... 30 2.0 01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157... 29 3.5 01_06_0513 - 29944888-29945943 29 4.7 01_05_0013 - 17156017-17157647,17157977-17158144,17160064-171601... 29 4.7 04_03_0059 - 10504901-10506127 28 6.2 03_05_0520 + 25139314-25139364,25139580-25139711,25141594-251417... 28 8.2 >10_03_0033 - 7248131-7248711,7248947-7249079,7249470-7249994, 7250545-7250764,7250913-7251145 Length = 563 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +1 Query: 400 SAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQWVRRRVSGYRARIRNHGHS 561 S GL LN S+A+A + ++P GG + WV S R+R HG S Sbjct: 50 SGGLNLN-SQADA-FPDFASYQQIIQPGSLGGMRGWVPPGSSSSEGRVRGHGTS 101 >01_07_0197 + 41912207-41912652,41913226-41913800,41913828-41915748, 41915836-41916049,41916143-41916394,41916469-41916528, 41916646-41916776,41916898-41917012,41917084-41917239 Length = 1289 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 79 YKEFLARG-ARKVTTGITGLWQPSVHSDVAF*SFDVG 186 YK F A G RKV GIT + PS+ D+AF S +G Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFDSAALG 669 >01_06_0513 - 29944888-29945943 Length = 351 Score = 28.7 bits (61), Expect = 4.7 Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -2 Query: 527 PETRRRTHCLEPPDSRGSTVSISL-PDSARLASALEAFRHNPADGSSHHRPLGR 369 P+TRR H EPP S S L D A A+A A +P+ SS P R Sbjct: 6 PQTRRPIHLAEPPLSPEPNPSSPLMDDGAAPAAAAAAELPSPSPSSSGTSPSPR 59 >01_05_0013 - 17156017-17157647,17157977-17158144,17160064-17160113, 17160796-17160833,17161102-17161212 Length = 665 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 427 KAEASLAESGKDMLTVEPRESGGSKQWVRRRVSGYRARIRNHGHSCFL 570 K +A+ AE G+ ++ E G + +RRR+ Y R HGH L Sbjct: 146 KGDAT-AEEGQQLVA---EEGAGKMKELRRRLVDYACHHRKHGHDALL 189 >04_03_0059 - 10504901-10506127 Length = 408 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 514 RRVSGYRARIRNHGHSCFLCEIVI 585 RRV G R RNH H CF I + Sbjct: 226 RRVMGVRLGQRNHAHGCFYWMITL 249 >03_05_0520 + 25139314-25139364,25139580-25139711,25141594-25141731, 25143191-25143241,25143662-25143751,25143854-25144000, 25144108-25144218,25144307-25144375,25144777-25145517, 25145840-25146004,25146376-25146442,25146580-25146704, 25148714-25148983,25149065-25149199,25149316-25149497, 25149669-25149744 Length = 849 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +3 Query: 303 VVAIVILLSTRGTAVSDIWFMHSAERPVVRTTIRGIMPERL*GRSQPSRI 452 VV I ST +VS + S RP+V TT ++P + RS P I Sbjct: 308 VVPTTISTSTAAVSVS-AETISSPVRPIVPTTTAAVLPASVTARSAPENI 356 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,911,260 Number of Sequences: 37544 Number of extensions: 437198 Number of successful extensions: 1113 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -