BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1126 (747 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 25 0.85 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.1 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 23 3.4 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 3.4 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 24.6 bits (51), Expect = 0.85 Identities = 21/77 (27%), Positives = 26/77 (33%) Frame = -2 Query: 260 QPTLRSVPLAATLRRYGPGTLYGKTAPFKTNLDRSRRDEKAEPPEHHISRYRLKQRDSVL 81 QPT P L YG G Y A K S KA EH + Y K +L Sbjct: 61 QPTTGYYPYDPALAAYGYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIML 120 Query: 80 GYIPVRSPLLRKSWLVS 30 I + +W + Sbjct: 121 AIITKMTLTQVSTWFAN 137 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 235 SPRPSVATGLAPSTGKRPRSRRTWTG 158 +P P+ G P PRS+R +TG Sbjct: 262 APSPTAGAGGLPPQVPSPRSQRRYTG 287 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 267 SQATHSKERPSRRDPPSLRAWHPLRE 190 SQA S++ DP ++ W P RE Sbjct: 99 SQAPASQQSLDASDPDAMGKWCPRRE 124 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 267 SQATHSKERPSRRDPPSLRAWHPLRE 190 SQA S++ DP ++ W P RE Sbjct: 255 SQAPASQQSLDASDPDAMGKWCPRRE 280 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,587 Number of Sequences: 336 Number of extensions: 3309 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -