BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1125 (693 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 33 0.18 At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.7 At1g76965.1 68414.m08961 glycine-rich protein 29 2.2 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 2.9 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 2.9 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.9 At5g42370.1 68418.m05159 expressed protein 29 3.9 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 3.9 At3g60520.1 68416.m06769 expressed protein 28 5.1 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.1 At5g45730.1 68418.m05622 DC1 domain-containing protein contains ... 27 8.9 At5g22390.1 68418.m02612 expressed protein 27 8.9 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 27 8.9 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 523 TFRTGSGPAFSGLPRIFLAVKSCRFRFVRDRHDSVRPPFNGQLRTGTDKGIRLSN*N 693 T+ T SG R++L+ R+ D HD + PFNG T + ++N N Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHTHITTDLNINNSN 234 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 540 RTRVLRPSADLPSRKVLSVSFRARSARFCTTAVQRSAQN 656 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 416 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 321 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 482 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 306 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 482 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 306 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 203 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 69 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 142 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 32 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 5 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 136 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At3g60520.1 68416.m06769 expressed protein Length = 129 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 370 GPQSQSLFRSYGSNLPTSLTYIILSTRGSSPWRPAADMGRTGATSPR 230 G S+ +RS S+ + ++ SS PAAD G+TG SPR Sbjct: 69 GGSSKRSYRSEYSSPHHQIKQQEINQTTSSSIPPAADKGKTGVPSPR 115 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 198 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 100 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g45730.1 68418.m05622 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 519 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = -1 Query: 393 PVQTRHAPVLRANP----YSEVTDPICRLPLPTLFYRLEALHLGDLLRIWDEPA 244 P +RH P+ + +P Y++ CR PL L Y + LR W PA Sbjct: 68 PCHSRH-PLKKVSPETIDYTDGKCQFCRSPLVDLMYHCSICNFSVDLRCWLNPA 120 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 77 ERSGKSFLFCLSVRVPWNPIEG 142 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 240 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 151 H H +P+ S S S+RTPP R +SR E Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,706,714 Number of Sequences: 28952 Number of extensions: 342719 Number of successful extensions: 1010 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -