BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1123 (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 69 5e-12 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 48 9e-06 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 47 1e-05 SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) 46 2e-05 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_41893| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_20905| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_47511| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_32885| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_19334| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.053 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.053 SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 30 1.5 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 29 3.5 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.5 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 29 4.6 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 28 6.0 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_56448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 28 8.0 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 68.5 bits (160), Expect = 5e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 153 TAGRWPWKSESAKECATTHLPKQPALKMDGAEA 251 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQA 33 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 60 GASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 68.5 bits (160), Expect = 5e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 153 TAGRWPWKSESAKECATTHLPKQPALKMDGAEA 251 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQA 33 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 60 GASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 68.5 bits (160), Expect = 5e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 153 TAGRWPWKSESAKECATTHLPKQPALKMDGAEA 251 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQA 112 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 139 GASLGETASSADLGGSSKYSNESFEDRSGERF 170 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 153 TAGRWPWKSESAKECATTHLPKQPALKMDGAEA 251 TAGR + ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQA 33 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 60 GASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 52.8 bits (121), Expect = 2e-07 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = -2 Query: 529 KTRHIDIDLSLSLGSTDSRATTVHAKPFSTSVLQGLAGVFATTTKICTDG 380 K + + LGST+ T VH +PFSTSV + L +FATTTKICT G Sbjct: 93 KIGRLQTEFPYLLGSTNPCPTAVHMEPFSTSVFKALIRIFATTTKICTGG 142 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 489 DRLTREQLLFTRNPSPRQSSRASLEYLLLPPRSA 388 DRLT QLLFT N SP +SS+ S EYLLLPPRSA Sbjct: 89 DRLTHVQLLFTWNLSPLRSSKLSFEYLLLPPRSA 122 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +3 Query: 174 KSESAKECATTHLPKQPALKMDGAEA 251 K ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQA 34 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 61 GASLGETASSADLGGSSKYSNESFEDRSGERF 92 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +3 Query: 174 KSESAKECATTHLPKQPALKMDGAEA 251 K ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +3 Query: 174 KSESAKECATTHLPKQPALKMDGAEA 251 K ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 180 ESAKECATTHLPKQPALKMDGAEA 251 ESAKEC TTHLPKQ ALKMDGA+A Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQA 33 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 60 GASLGETASSADLGGSSKYSNESFEDRSGERF 91 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +1 Query: 100 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 207 + +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5) Length = 164 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/58 (50%), Positives = 32/58 (55%), Gaps = 7/58 (12%) Frame = -2 Query: 502 SLSLGSTDSRATTVHAKPFSTSVLQGLAGVFATTTKICTDG----GSKR---LTPRPF 350 S GST+ T VH PFSTS Q L +FATTTKIC G GS + TP PF Sbjct: 37 SYPCGSTNPCPTAVHMDPFSTSGFQALILIFATTTKICPGGRFTQGSGKGWVTTPTPF 94 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 183 SAKECATTHLPKQPALKMDGAEA 251 SAKEC TTHLPKQ ALKMDGA+A Sbjct: 5 SAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 183 SAKECATTHLPKQPALKMDGAEA 251 SAKEC TTHLPKQ ALKMDGA+A Sbjct: 5 SAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 183 SAKECATTHLPKQPALKMDGAEA 251 SAKEC TTHLPKQ ALKMDGA+A Sbjct: 5 SAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +3 Query: 183 SAKECATTHLPKQPALKMDGAEA 251 SAKEC TTHLPKQ ALKMDGA+A Sbjct: 5 SAKECVTTHLPKQLALKMDGAQA 27 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 54 GASLGETASSADLGGSSKYSNESFEDRSGERF 85 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +3 Query: 174 KSESAKECATTHLPKQPALKMDGAEAFAYTLP 269 K ESAKEC TTHLPKQ ALKM + YT+P Sbjct: 2 KVESAKECVTTHLPKQLALKMMALKRRTYTVP 33 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +3 Query: 186 AKECATTHLPKQPALKMDGAEA 251 AKEC TTHLPKQ ALKMDGA+A Sbjct: 39 AKECVTTHLPKQLALKMDGAQA 60 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +1 Query: 100 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 192 + +RS D KGVG S QQDGGHGS NP + Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 87 GASLGETASSADLGGSSKYSNESFEDRSGERF 118 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +1 Query: 100 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 192 + +RS D KGVG S QQDGGHGS NPL+ Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 189 KECATTHLPKQPALKMDGAEA 251 KEC TT LPKQ ALKMDGA+A Sbjct: 40 KECVTTPLPKQLALKMDGAQA 60 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/32 (62%), Positives = 23/32 (71%), Gaps = 5/32 (15%) Frame = +2 Query: 374 GASVG-----ADLGGSSKYSSEALED*RGEGF 454 GAS+G ADLGGSSKYS+E+ ED GE F Sbjct: 87 GASLGETASSADLGGSSKYSNESFEDRSGERF 118 >SB_41893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/63 (41%), Positives = 32/63 (50%) Frame = -2 Query: 610 PLPGSGIGTGFPFAQRALFFIIFKNYKKTRHIDIDLSLSLGSTDSRATTVHAKPFSTSVL 431 P PGSGI T FPF +R K + + LGST+ T VH +PFSTSV Sbjct: 78 PRPGSGILTRFPFDRRP----------KIGRLQTEFPYLLGSTNPCPTAVHMEPFSTSVF 127 Query: 430 QGL 422 + L Sbjct: 128 KAL 130 >SB_20905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/63 (41%), Positives = 32/63 (50%) Frame = -2 Query: 610 PLPGSGIGTGFPFAQRALFFIIFKNYKKTRHIDIDLSLSLGSTDSRATTVHAKPFSTSVL 431 P PGSGI T FPF +R K + + LGST+ T VH +PFSTSV Sbjct: 53 PRPGSGILTRFPFDRRP----------KIGRLQTEFPYLLGSTNPCPTAVHMEPFSTSVF 102 Query: 430 QGL 422 + L Sbjct: 103 KAL 105 >SB_47511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/63 (41%), Positives = 32/63 (50%) Frame = -2 Query: 610 PLPGSGIGTGFPFAQRALFFIIFKNYKKTRHIDIDLSLSLGSTDSRATTVHAKPFSTSVL 431 P PGSGI T FPF +R K + + LGST+ T VH +PFSTSV Sbjct: 21 PRPGSGILTRFPFDRRP----------KIGRLQTEFPYLLGSTNPCPTAVHMEPFSTSVF 70 Query: 430 QGL 422 + L Sbjct: 71 KAL 73 >SB_32885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/63 (41%), Positives = 32/63 (50%) Frame = -2 Query: 610 PLPGSGIGTGFPFAQRALFFIIFKNYKKTRHIDIDLSLSLGSTDSRATTVHAKPFSTSVL 431 P PGSGI T FPF +R K + + LGST+ T VH +PFSTSV Sbjct: 24 PRPGSGILTRFPFDRRP----------KIGRLQTEFPYLLGSTNPCPTAVHMEPFSTSVF 73 Query: 430 QGL 422 + L Sbjct: 74 KAL 76 >SB_19334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/63 (41%), Positives = 32/63 (50%) Frame = -2 Query: 610 PLPGSGIGTGFPFAQRALFFIIFKNYKKTRHIDIDLSLSLGSTDSRATTVHAKPFSTSVL 431 P PGSGI T FPF +R K + + LGST+ T VH +PFSTSV Sbjct: 21 PRPGSGILTRFPFDRRP----------KIGRLQTEFPYLLGSTNPCPTAVHMEPFSTSVF 70 Query: 430 QGL 422 + L Sbjct: 71 KAL 73 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +2 Query: 113 NAHGTP*KALVAHDSRTVAMEVGIR 187 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.9 bits (79), Expect = 0.030 Identities = 23/57 (40%), Positives = 28/57 (49%) Frame = -2 Query: 610 PLPGSGIGTGFPFAQRALFFIIFKNYKKTRHIDIDLSLSLGSTDSRATTVHAKPFST 440 P PGSGI T FPF +R K + + LGST+ T VH +PFST Sbjct: 71 PRPGSGILTRFPFDRRP----------KIGRLQTEFPYLLGSTNPCPTAVHMEPFST 117 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.1 bits (77), Expect = 0.053 Identities = 30/79 (37%), Positives = 34/79 (43%) Frame = -3 Query: 252 TLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLSTTFGXXXX 73 TL+RHPFSGLVASA + PT F G L+ FG Sbjct: 27 TLERHPFSGLVASAEQ--------PT------------PFVGSDERRLWHLNRAFGSSRI 66 Query: 72 XXXAYQNWPTWLRHQISGF 16 AYQ WPT H +SGF Sbjct: 67 ASSAYQKWPTRNSHSLSGF 85 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 35.1 bits (77), Expect = 0.053 Identities = 30/79 (37%), Positives = 34/79 (43%) Frame = -3 Query: 252 TLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLSTTFGXXXX 73 TL+RHPFSGLVASA + PT F G L+ FG Sbjct: 25 TLERHPFSGLVASAEQ--------PT------------PFVGSDERRLWHLNRAFGSSRI 64 Query: 72 XXXAYQNWPTWLRHQISGF 16 AYQ WPT H +SGF Sbjct: 65 ASSAYQKWPTSNSHSLSGF 83 >SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +3 Query: 381 PSVQILVVVANTPARPWRTDVEKG 452 P VQILVVVAN R +T+VEKG Sbjct: 39 PPVQILVVVANIQMRALKTEVEKG 62 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = -2 Query: 610 PLPGSGIGTGFPFAQRALFFIIFKNYKKTRHIDIDLSLSLGSTDSRATTVHAKPF 446 P PGSGI T FPF +R K + + LGST+ T VH +P+ Sbjct: 84 PRPGSGILTRFPFDRR----------PKIGRLQTEFPYLLGSTNPCPTAVHMEPW 128 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 203 DSPAEATSPENGWR*SVCLYTTVTGTCDAKFLIWYH 310 +SP + S G VC +TG C A+F+ W++ Sbjct: 609 ESPKKVRSAHKGHATQVCSLPKLTGPCMARFIRWHY 644 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 54 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 96 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 205 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 110 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 444 PRQSSRASLEYLLLPPRSAPTEAPSGSRPDP 352 PR +S++S+ + PP S P AP+ +P P Sbjct: 165 PRTTSQSSIPGVAPPPSSQPAPAPAPPQPAP 195 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ FG AYQ WPT H +SGF Sbjct: 17 LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 28.3 bits (60), Expect = 6.0 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +2 Query: 242 R*SVCLYTTVTGTCDAKFLIWYH*AVT-SRTCATESAEGSGREPLGASVGADLGGSSKYS 418 R S L G C A+ L W + SR C T ++E +G + G SVG+ L + Sbjct: 129 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASELTGSKQRGPSVGSYLVDIQSFE 188 Query: 419 SEAL 430 AL Sbjct: 189 QLAL 192 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 102 LSTTFGXXXXXXXAYQNWPTWLRHQISGF 16 L+ +G AYQ WPT H +SGF Sbjct: 17 LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_56448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 395 LGGSSKYSSEALED*RG 445 LGGSSKYS+E+ ED G Sbjct: 2 LGGSSKYSNESFEDRSG 18 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 551 EK*RPLSERESGSYSGTRQRNRFNNRSLVFKNECSTG 661 EK R ++ R+ NNRS+VF EC TG Sbjct: 34 EKTRKTKSADNFVMKYNNNRSYHNNRSVVFLGECMTG 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,583,486 Number of Sequences: 59808 Number of extensions: 494949 Number of successful extensions: 2168 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 2035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2161 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -