BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1121 (550 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK125693-1|BAC86247.1| 321|Homo sapiens protein ( Homo sapiens ... 31 2.7 AY024361-1|AAK00583.1| 4911|Homo sapiens MLL3 protein. 30 4.6 AF264750-1|AAF74766.2| 4025|Homo sapiens ALR-like protein protein. 30 4.6 AC006474-1|AAS00364.1| 2185|Homo sapiens unknown protein. 30 4.6 AB040939-1|BAA96030.2| 3310|Homo sapiens KIAA1506 protein protein. 30 4.6 >AK125693-1|BAC86247.1| 321|Homo sapiens protein ( Homo sapiens cDNA FLJ43705 fis, clone TESOP2001818. ). Length = 321 Score = 31.1 bits (67), Expect = 2.7 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 17 PIPEPGSGTVSIIVPSSLKTSVRRGNPKWPEDAAER 124 P+P G+ T ++PS+L+ ++ G P W ED+ R Sbjct: 228 PLPPKGTETFFCVLPSALRAALSCG-PSWGEDSGPR 262 >AY024361-1|AAK00583.1| 4911|Homo sapiens MLL3 protein. Length = 4911 Score = 30.3 bits (65), Expect = 4.6 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = -3 Query: 284 RHLHVHPSPEFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRRLQ 105 RH + P P+F GP+ RR L PN + + D ++ S +++ S S + Sbjct: 2589 RHGNFIPRPDFPGPRHTDPMRRPPQGL--PNQLPVHPDLEQVPPSQQEQGHSVHSSSMVM 2646 Query: 104 ATLGYPV 84 TL +P+ Sbjct: 2647 RTLNHPL 2653 >AF264750-1|AAF74766.2| 4025|Homo sapiens ALR-like protein protein. Length = 4025 Score = 30.3 bits (65), Expect = 4.6 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = -3 Query: 284 RHLHVHPSPEFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRRLQ 105 RH + P P+F GP+ RR L PN + + D ++ S +++ S S + Sbjct: 1650 RHGNFIPRPDFPGPRHTDPMRRPPQGL--PNQLPVHPDLEQVPPSQQEQGHSVHSSSMVM 1707 Query: 104 ATLGYPV 84 TL +P+ Sbjct: 1708 RTLNHPL 1714 >AC006474-1|AAS00364.1| 2185|Homo sapiens unknown protein. Length = 2185 Score = 30.3 bits (65), Expect = 4.6 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = -3 Query: 284 RHLHVHPSPEFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRRLQ 105 RH + P P+F GP+ RR L PN + + D ++ S +++ S S + Sbjct: 1650 RHGNFIPRPDFPGPRHTDPMRRPPQGL--PNQLPVHPDLEQVPPSQQEQGHSVHSSSMVM 1707 Query: 104 ATLGYPV 84 TL +P+ Sbjct: 1708 RTLNHPL 1714 >AB040939-1|BAA96030.2| 3310|Homo sapiens KIAA1506 protein protein. Length = 3310 Score = 30.3 bits (65), Expect = 4.6 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = -3 Query: 284 RHLHVHPSPEFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRRLQ 105 RH + P P+F GP+ RR L PN + + D ++ S +++ S S + Sbjct: 2034 RHGNFIPRPDFPGPRHTDPMRRPPQGL--PNQLPVHPDLEQVPPSQQEQGHSVHSSSMVM 2091 Query: 104 ATLGYPV 84 TL +P+ Sbjct: 2092 RTLNHPL 2098 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,906,781 Number of Sequences: 237096 Number of extensions: 2008056 Number of successful extensions: 5786 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5786 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5421005376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -