BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1120 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0572 - 19604643-19604745,19604947-19605629,19605786-196062... 41 8e-04 06_03_0995 + 26704029-26704107,26704543-26704595,26704907-267051... 29 4.4 12_01_0673 - 5745956-5750346,5750788-5750872,5751018-5751082,575... 28 5.8 >07_03_0572 - 19604643-19604745,19604947-19605629,19605786-19606284, 19606370-19606878,19607110-19607148,19607347-19607411, 19609081-19609201,19610229-19610315,19611096-19611179, 19611925-19612175,19612869-19612962,19613043-19613284, 19614187-19614505 Length = 1031 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +1 Query: 7 HGMKVVEYFSKRDG--GLLALEQMWREHFINVMKPNYLPDLWSVKHNEER 150 HG +VVE G + Q WR+ F+ + P YLP W++KH+ R Sbjct: 952 HGKQVVELLLSNGGEEAINQFSQRWRQVFVASLHPRYLPSGWNIKHSGRR 1001 >06_03_0995 + 26704029-26704107,26704543-26704595,26704907-26705122, 26705328-26705411,26705498-26705572,26705711-26705794, 26706179-26706268,26707463-26707558,26707655-26707726, 26708500-26708604,26708804-26708845 Length = 331 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 227 YIQDHLAPITLRSFSDNLPSLHFIHNLSSL 138 +I HL P+TLR NL H IH S+ Sbjct: 91 HIDQHLVPLTLRDNLYNLQLKHMIHQALSI 120 >12_01_0673 - 5745956-5750346,5750788-5750872,5751018-5751082, 5751816-5751993 Length = 1572 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 227 YIQDHLAPITLRSFSDNLPSLHFIHNLSSLCLTDH 123 ++ D + + + S + +LPSL + L SLC T+H Sbjct: 1385 HLVDSRSSLRISSLTIDLPSLLLVEPLKSLCHTEH 1419 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,863,785 Number of Sequences: 37544 Number of extensions: 371829 Number of successful extensions: 706 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -