BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1120 (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 23 6.5 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 23 6.5 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 8.7 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 8.7 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 23.4 bits (48), Expect = 6.5 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = -2 Query: 536 LVSLK*HNYRK*NIVAGDVTSRVL*KSPQSFLLLLNSHHCIGSLFHLISYQY 381 L LK H +R ++A L PQ+F+ L H I ++Y Y Sbjct: 151 LKPLKVHEHRAVLMIAAAWIMSGLCSLPQAFIFHLEGHPNITGYQQCVTYHY 202 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 23.4 bits (48), Expect = 6.5 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = -2 Query: 536 LVSLK*HNYRK*NIVAGDVTSRVL*KSPQSFLLLLNSHHCIGSLFHLISYQY 381 L LK H +R ++A L PQ+F+ L H I ++Y Y Sbjct: 151 LKPLKVHEHRAVLMIAAAWIMSGLCSLPQAFIFHLEGHPNITGYQQCVTYHY 202 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 151 LWIKWSEGRLSENDLKVIGARWS 219 LWI W EG +L ++ A WS Sbjct: 370 LWISWEEGMKVFEEL-LLDADWS 391 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.0 bits (47), Expect = 8.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 239 SLPIYIQDHLAPITLRSFSDNLPSLH 162 +LP Y Q PITL D P LH Sbjct: 620 TLPFYKQLLNKPITLSDIEDVDPDLH 645 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 737,143 Number of Sequences: 2352 Number of extensions: 16445 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -