BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1119 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 1.0 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 4.1 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 21 7.2 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 21 7.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 7.2 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 7.2 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.8 bits (49), Expect = 1.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 284 LPQMHHSMSYITSDSRCSCP 343 L Q +HS +I D R +CP Sbjct: 215 LEQWNHSKVHIREDKRLTCP 234 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +1 Query: 49 EEVESLERQLALTQKALTQCKRKCDERIKR 138 E + + + + K C R DE+IKR Sbjct: 4 ENITDVLKHVWFLSKLFLLCPRSIDEKIKR 33 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 259 GSRPPGGCAPADAPQ 303 G+R PG PA+ PQ Sbjct: 171 GTRIPGQLEPANVPQ 185 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 259 GSRPPGGCAPADAPQ 303 G+R PG PA+ PQ Sbjct: 178 GTRIPGQLEPANVPQ 192 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 262 SRPPGGCAPADAPQH 306 S P G P DAP H Sbjct: 184 SSSPPGVFPVDAPMH 198 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 183 ADETLRQSYRAARP 224 AD+T R+SY A+P Sbjct: 128 ADKTYRRSYTHAKP 141 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,381 Number of Sequences: 336 Number of extensions: 1741 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -