BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1118 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 63 2e-10 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) 47 1e-05 SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 33 0.26 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_58248| Best HMM Match : Pox_A32 (HMM E-Value=0.97) 31 0.59 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 29 2.4 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_42244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 29 3.2 SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) 29 4.2 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 29 4.2 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 29 4.2 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 28 5.5 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 28 5.5 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 28 5.5 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 28 5.5 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 28 5.5 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 28 5.5 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 28 5.5 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_47729| Best HMM Match : ASC (HMM E-Value=1.8e-07) 28 7.3 SB_10665| Best HMM Match : PT (HMM E-Value=6.2) 28 7.3 SB_5495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_8578| Best HMM Match : DUF807 (HMM E-Value=6.7) 28 7.3 SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) 27 9.7 SB_31491| Best HMM Match : Pox_A32 (HMM E-Value=0.094) 27 9.7 SB_10587| Best HMM Match : DGCR6 (HMM E-Value=8.6e-07) 27 9.7 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 438 HSEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 334 ++EHWAEITLRQH PSQCFVLI+QSDSP CQF Sbjct: 48 NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +1 Query: 508 MPRHLISDAHEWINEIPTVPIYYLAKP 588 MPRHLISDAHEWINEIPTVPI +P Sbjct: 1 MPRHLISDAHEWINEIPTVPIIEFLQP 27 >SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) Length = 167 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 426 SALNVNVKKFKQARVNGGSNYDSL 497 +ALNV VKKF QARVNGGSNYDSL Sbjct: 28 AALNVKVKKFNQARVNGGSNYDSL 51 >SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 429 ALNVNVKKFKQARVNGGSNYDSL 497 ALNV VKKF QARVNG SNYDSL Sbjct: 2 ALNVKVKKFNQARVNGWSNYDSL 24 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -3 Query: 634 GSSFPADSPKPVPLAVVSLDSR 569 GSSFPAD KPVPLAVVSLDSR Sbjct: 109 GSSFPADCAKPVPLAVVSLDSR 130 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +3 Query: 423 PSALNVNVKKFKQARVNGGSNYDS 494 PSALNV VKKF QARVNGG +S Sbjct: 31 PSALNVKVKKFNQARVNGGDPLES 54 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 91 TGPHPLPVQTRHA-PVLRANPYSEVTDPICR 2 +GP PL P LRANP+ EVTD CR Sbjct: 23 SGPGPLASSLSPTDPTLRANPFPEVTDLFCR 53 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 91 TGPHPLPVQTRHA-PVLRANPYSEVTDPICR 2 +GP PL P LRANP+ EVTD CR Sbjct: 127 SGPGPLASSLSPTDPTLRANPFPEVTDLFCR 157 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 91 TGPHPLPVQTRHA-PVLRANPYSEVTDPICR 2 +GP PL P LRANP+ EVTD CR Sbjct: 23 SGPGPLASSLSPTDPTLRANPFPEVTDLFCR 53 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 91 TGPHPLPVQTRHA-PVLRANPYSEVTDPICR 2 +GP PL P LRANP+ EVTD CR Sbjct: 63 SGPGPLASSLSPTDPTLRANPFPEVTDLFCR 93 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 32.3 bits (70), Expect = 0.34 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 102 PDPAPDRIRFPS-KPDTPRSSEPILIPKLRIQFAD 1 P PAP R+ + + EPIL PKLRI FAD Sbjct: 19 PRPAPGRVHWLQVSARQTQPLEPILFPKLRIYFAD 53 >SB_58248| Best HMM Match : Pox_A32 (HMM E-Value=0.97) Length = 540 Score = 31.5 bits (68), Expect = 0.59 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 2/72 (2%) Frame = +2 Query: 14 IRNFGIRIGSEDRGVSGLDGKRMRSGAGSGRCSCVMFVLAS*YFNIMRPQ--KLYIFNMT 187 I G+R+ + GV L+ KR SG G+ +C MFV+A N+M Q + T Sbjct: 143 IHGGGLRLVNTRDGVH-LEIKRTASGTGT--VNCHMFVVADALMNLMNGQLESIQYLAHT 199 Query: 188 LAKIVLRFGLDP 223 ++ R G+DP Sbjct: 200 PERVSARSGMDP 211 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.1 bits (67), Expect = 0.78 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -1 Query: 105 RPDPAPDRIRFPS-KPDTPRSSEPILIPKLRIQFAD 1 R +PDR+ + + EPIL+PKLRI FAD Sbjct: 6 RASASPDRVHWLQVSARQTQPLEPILLPKLRIYFAD 41 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 105 RPDPAPDRIRFPS-KPDTPRSSEPILIPKLRIQFAD 1 R +PDR+ + + EPIL PKLRI FAD Sbjct: 6 RASASPDRVHWLQVSARQTQPLEPILFPKLRIYFAD 41 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 105 RPDPAPDRIRFPS-KPDTPRSSEPILIPKLRIQFAD 1 R +PDR+ + + EPIL PKLRI FAD Sbjct: 6 RASASPDRVHWLQVSARQTQPLEPILFPKLRIYFAD 41 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S EPIL PKLRI FAD Sbjct: 36 QSLEPILFPKLRIYFAD 52 >SB_42244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -3 Query: 184 HIKYIQFLRPHYIKILTR*--NEHNARTSTRPGTGPHPLPVQTRHAP 50 H + I+ +RP + L R + H + T T G HP+PV T P Sbjct: 239 HKQEIRDVRPSLVTDLARHAGSPHVSATPTAAGVSAHPIPVATSKVP 285 >SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1283 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 127 NEHNARTSTRPGTGPHPLPVQTRHAPVLRANP 32 +E +A TRPG P P+P Q + P + P Sbjct: 588 HERSAGPVTRPGKRPSPVPQQNKEPPSKKPKP 619 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 353 ESDCLIKTKHCDGPRGC*RNVISAQCSE 436 E DC+ +KHCDG C C E Sbjct: 73 EGDCIPLSKHCDGTWDCQHGTDEMDCQE 100 >SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) Length = 1497 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +2 Query: 14 IRNFGIRIGSEDRGVSGLDGKRMRSGAGSGRCSCVMFVLAS*YFNIMRPQ 163 I G+R+ + GV L+ KR SG G+ +C +FV+A N+M Q Sbjct: 907 IHGGGLRLVNTRDGVH-LEIKRTASGTGTVFVNCHVFVVADAQMNLMNGQ 955 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -1 Query: 102 PDPAPDRIRFPS-KPDTPRSSEPILIPKLRIQFAD 1 P +P R+ + + EPIL PKLRI FAD Sbjct: 31 PSASPGRVHWLQVSARQTQPLEPILFPKLRIYFAD 65 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 57 TPRSSEPILIPKLRIQFAD 1 T + EPIL PKLRI FAD Sbjct: 249 TDPTLEPILFPKLRIYFAD 267 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 63 PDTPRSSEPILIPKLRIQFAD 1 P + EPIL PKLRI FAD Sbjct: 84 PRQTQPLEPILFPKLRIYFAD 104 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 178 EPILFPKLRIYFAD 191 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 77 EPILFPKLRIYFAD 90 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 77 EPILFPKLRIYFAD 90 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 40 EPILFPKLRIYFAD 53 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 112 EPILFPKLRIYFAD 125 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 40 EPILFPKLRIYFAD 53 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 34 EPILFPKLRIYFAD 47 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 112 EPILFPKLRIYFAD 125 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 40 EPILFPKLRIYFAD 53 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 112 EPILFPKLRIYFAD 125 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 46 EPILFPKLRIYFAD 59 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 40 EPILFPKLRIYFAD 53 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 40 EPILFPKLRIYFAD 53 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 181 EPILFPKLRIYFAD 194 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 49 EPILFPKLRIYFAD 62 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 77 EPILFPKLRIYFAD 90 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 40 EPILFPKLRIYFAD 53 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 77 EPILFPKLRIYFAD 90 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -1 Query: 51 RSSEPILIPKLRIQFAD 1 +S +PIL PKLRI FAD Sbjct: 36 QSLDPILFPKLRIYFAD 52 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 91 TGPHPLPVQTRHA-PVLRANPYSEVTD 14 +GP PL P LRANP+ EVTD Sbjct: 23 SGPGPLASSLSPTDPTLRANPFPEVTD 49 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 151 EPILFPKLRIYFAD 164 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 112 EPILFPKLRIYFAD 125 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 111 EPILFPKLRIYFAD 124 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 734 EPILFPKLRIYFAD 747 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 112 EPILFPKLRIYFAD 125 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 40 EPILFPKLRIYFAD 53 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 60 EPILFPKLRIYFAD 73 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 150 EPILFPKLRIYFAD 163 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 46 EPILFPKLRIYFAD 59 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 191 EPILFPKLRIYFAD 204 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 150 EPILFPKLRIYFAD 163 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 137 EPILFPKLRIYFAD 150 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 77 EPILFPKLRIYFAD 90 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 93 APDRIRFPSKPDTPRSSEPILIPKLRIQFAD 1 +P R+ + + +PIL PKLRI FAD Sbjct: 21 SPGRVHWLQVSARQTNLKPILFPKLRIYFAD 51 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 78 EPILFPKLRIYFAD 91 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 78 EPILFPKLRIYFAD 91 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 77 EPILFPKLRIYFAD 90 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 28 EPILFPKLRIYFAD 41 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 52 EPILFPKLRIYFAD 65 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 42 EPILIPKLRIQFAD 1 EPIL PKLRI FAD Sbjct: 39 EPILFPKLRIYFAD 52 >SB_47729| Best HMM Match : ASC (HMM E-Value=1.8e-07) Length = 387 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 107 IDQTRHRTASASRPNPTRPGPQSQSLFRSYGSNL 6 +DQ H AS SR N T +++ + R YG N+ Sbjct: 125 LDQLDHIKASLSRVNRTNERFETEEMVRLYGHNI 158 >SB_10665| Best HMM Match : PT (HMM E-Value=6.2) Length = 215 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -3 Query: 103 TRPGTGPHPLPVQTRHAP--VLRANPYSEVTDP 11 TR GPH P +TRH P P+ TDP Sbjct: 26 TRTRHGPHTDPTRTRHGPHTDTTRTPHGHDTDP 58 >SB_5495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 27.9 bits (59), Expect = 7.3 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -1 Query: 87 DRIRFPSKPDTPRSSEPILIPKLRIQFAD 1 + +++P+ P P SS PI+ + + FA+ Sbjct: 154 ETLKYPTSPSAPSSSSPIIFRRTPLGFAE 182 >SB_8578| Best HMM Match : DUF807 (HMM E-Value=6.7) Length = 139 Score = 27.9 bits (59), Expect = 7.3 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -1 Query: 87 DRIRFPSKPDTPRSSEPILIPKLRIQFAD 1 + +++P+ P P SS PI+ + + FA+ Sbjct: 77 ETLKYPTSPSAPSSSSPIIFRRTPLGFAE 105 >SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) Length = 242 Score = 27.5 bits (58), Expect = 9.7 Identities = 26/97 (26%), Positives = 35/97 (36%), Gaps = 3/97 (3%) Frame = -3 Query: 292 SRTKRNRHDLTARRSAEGRRTRVRIQSET*DDFRECHIKYIQFLRPHYIKILTR*NEHNA 113 +RT+ H T R + +T+ R ++ H Q PH H Sbjct: 141 TRTRHEPHTDTTRTHTDPTQTQHRPNTDPTQTQHRPHTDPTQ--TPHGPHTDPTWTPHRP 198 Query: 112 RTS-TRPGTGPHPLPVQTRHAPVL--RANPYSEVTDP 11 T TR GPH P T H P NP+ T+P Sbjct: 199 NTDPTRTPHGPHTDPTWTPHGPHTDPTRNPHGTHTEP 235 >SB_31491| Best HMM Match : Pox_A32 (HMM E-Value=0.094) Length = 544 Score = 27.5 bits (58), Expect = 9.7 Identities = 24/70 (34%), Positives = 37/70 (52%) Frame = +2 Query: 14 IRNFGIRIGSEDRGVSGLDGKRMRSGAGSGRCSCVMFVLAS*YFNIMRPQKLYIFNMTLA 193 I G+R+ + GV L+ KR SG G+ +C +FV+A N+M Q L +N Sbjct: 285 IHGGGLRLVNTRDGVH-LEIKRTASGTGN--VNCHVFVVADTQMNLMNGQ-LDPYN---T 337 Query: 194 KIVLRFGLDP 223 + + R G+DP Sbjct: 338 EHIRRSGMDP 347 >SB_10587| Best HMM Match : DGCR6 (HMM E-Value=8.6e-07) Length = 423 Score = 27.5 bits (58), Expect = 9.7 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = -3 Query: 283 KRNRHDLTARRSAEGRRTRVRIQSET*DDFRECHIKYIQFLRPHYIKILTR*NEHNARTS 104 K N D + R + I +T ++ +E I+ Q RPH+I I+ + NE + + Sbjct: 261 KTNEEDKEEIEKNQHRPHHIPIVQKTNEEDKE-EIEKNQH-RPHHIPIVEKTNEEDKKEI 318 Query: 103 TRPGTGPHPLPV 68 + PH +P+ Sbjct: 319 EKNQHRPHHIPI 330 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,098,869 Number of Sequences: 59808 Number of extensions: 457137 Number of successful extensions: 1662 Number of sequences better than 10.0: 248 Number of HSP's better than 10.0 without gapping: 1533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1660 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -