BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1117 (309 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 37 0.003 SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.003 SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.007 SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.009 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.016 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.14 SB_18006| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_13724| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.33 SB_54855| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.33 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.44 SB_37801| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.44 SB_12791| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.44 SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.58 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 29 0.58 SB_4196| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.77 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.0 SB_58603| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_7296| Best HMM Match : PHD (HMM E-Value=0.0013) 28 1.3 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.8 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 28 1.8 SB_41893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.8 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.8 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 28 1.8 SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.8 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 27 2.4 SB_58033| Best HMM Match : HSA (HMM E-Value=3.2) 27 3.1 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 27 3.1 SB_105| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_48576| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_20253| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.4 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 26 7.2 SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_42957| Best HMM Match : TSP_1 (HMM E-Value=6.1e-13) 26 7.2 SB_23929| Best HMM Match : PT (HMM E-Value=0.21) 26 7.2 SB_14707| Best HMM Match : A_deamin (HMM E-Value=0) 26 7.2 SB_8277| Best HMM Match : DUF827 (HMM E-Value=1.7) 26 7.2 SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 26 7.2 SB_47352| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_46792| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_42469| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_4740| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47799| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44329| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 25 9.5 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 25 9.5 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 25 9.5 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_22744| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_21421| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_19196| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_17711| Best HMM Match : HECT (HMM E-Value=4.9) 25 9.5 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 25 9.5 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 25 9.5 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 25 9.5 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_1184| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_620| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_597| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 25 9.5 SB_141| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_59761| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 25 9.5 SB_59213| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_59171| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58876| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58614| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58352| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_58007| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_57897| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_56954| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_56879| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_56115| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_55873| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_55845| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_55688| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54804| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54790| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54567| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54499| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54386| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54218| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_54085| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53994| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53889| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53584| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53528| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53167| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52951| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52470| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52351| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52243| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_52155| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51935| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51772| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51744| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51473| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 25 9.5 SB_51166| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50956| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50890| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50848| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50784| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_50065| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 25 9.5 SB_49853| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49752| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49373| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49203| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_49034| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48938| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48681| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48381| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_48366| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47714| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47686| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_47543| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46918| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46892| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46860| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46695| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46385| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46375| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46256| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46190| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46113| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_45354| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_45337| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_45243| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44997| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44632| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44443| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44357| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43924| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43592| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43485| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43398| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43168| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_43053| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42602| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42357| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42118| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_41902| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_41894| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 25 9.5 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40838| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40537| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40477| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40428| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40402| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 >SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 538 Score = 37.1 bits (82), Expect = 0.003 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGAL 205 CGY Y+ R SP FQG + +GH +KCGAL Sbjct: 115 CGYEYDRTRKSM--SSPNFQGRRERTGHHKKCGAL 147 >SB_12021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 37.1 bits (82), Expect = 0.003 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGAL 205 CGY Y+ R SP FQG + +GH +KCGAL Sbjct: 9 CGYEYDRTRKSM--SSPNFQGRRERTGHHKKCGAL 41 >SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 35.9 bits (79), Expect = 0.007 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEF-QGPQRVSGHRRKCGAL 205 CGY Y+ R ++V PEF +G + +GH +KCGAL Sbjct: 9 CGYEYDRTRKINVF--PEFSKGRRERTGHHKKCGAL 42 >SB_57695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 35.5 bits (78), Expect = 0.009 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGAL 205 CGY Y+ R SP F+G + +GH +KCGAL Sbjct: 9 CGYEYDRTRKSM--SSPNFKGRRERTGHHKKCGAL 41 >SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 34.7 bits (76), Expect = 0.016 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGAL 205 CGY Y+ R SP+FQGP R +KCGAL Sbjct: 9 CGYEYDRTRKSM--SSPKFQGPSRAHRTPQKCGAL 41 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 31.5 bits (68), Expect = 0.14 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKC 214 CGY Y+ R SP FQG + +GH +KC Sbjct: 71 CGYEYDRTRKSM--SSPNFQGRRERTGHHKKC 100 >SB_18006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 31.1 bits (67), Expect = 0.19 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEF-QGPQRVSGHRRKCGAL 205 CGY Y+ R SP F +G + +GH +KCGAL Sbjct: 9 CGYEYDRTRKSM--SSPNFSRGRRERTGHHKKCGAL 42 >SB_13724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 30.3 bits (65), Expect = 0.33 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGAL 205 CGY Y+ R + F+G + +GH RKCGAL Sbjct: 9 CGYEYDRTRKSCLPRI--FKGRRERTGHHRKCGAL 41 >SB_54855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 30.3 bits (65), Expect = 0.33 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKC 214 CGY Y+ R + SP+F GP R +KC Sbjct: 9 CGYEYDRTRK--IMSSPKFSGPSRAHRTHKKC 38 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.9 bits (64), Expect = 0.44 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKC 214 CGY Y+ R SP F+G + +GH +KC Sbjct: 9 CGYEYDRTRKSM--SSPNFKGRRERTGHHKKC 38 >SB_37801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 29.9 bits (64), Expect = 0.44 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKC 214 CGY Y+ R + P+ FQG + +GH +KC Sbjct: 9 CGYEYDRTRKSCLPPN--FQGRRERTGHHKKC 38 >SB_12791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 29.9 bits (64), Expect = 0.44 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRK 217 CGY Y+ R + SP FQG + +GH +K Sbjct: 9 CGYEYDRTRK--IMSSPNFQGRRERTGHHKK 37 >SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.5 bits (63), Expect = 0.58 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALRVPNH 190 CGY Y+ R SP FQGP R ++ G +R +H Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMRPYDH 46 >SB_27396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.5 bits (63), Expect = 0.58 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALRVPNH 190 CGY Y+ R SP FQGP R ++ G +R +H Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMRPYDH 46 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 29.5 bits (63), Expect = 0.58 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALRVPNH 190 CGY Y+ R SP FQGP R ++ G +R +H Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMRPYDH 108 >SB_4196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 474 Score = 29.1 bits (62), Expect = 0.77 Identities = 15/71 (21%), Positives = 30/71 (42%) Frame = +3 Query: 6 GNPVPIPEPGSGTVSIIVPSSLKTSVRRGNPKWXEDAAERSGKSFLFCLSVRVPWNPIEG 185 G P P+ + + +P L+ S RG P W +++ + V +PW + Sbjct: 169 GIPTPVDKMTQAQLRAFIPMMLRYSTGRGKPGWGKESTRPN------WWPVDLPWQNVRS 222 Query: 186 RYGSEREEHRI 218 SE ++ ++ Sbjct: 223 DCRSEEQKAKV 233 >SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 28.7 bits (61), Expect = 1.0 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRV-SGHRRKCGAL 205 CGY Y+ R P EF R +GH +KCGAL Sbjct: 9 CGYEYDRTRKSMSFP--EFSRAVRERTGHHKKCGAL 42 >SB_58603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 28.3 bits (60), Expect = 1.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 286 ATSPRTSLT*ISRSAESIRTPPQMRCSSRSEPYLP 182 A+S ++ + S SAE I+TPP M S P +P Sbjct: 124 ASSSTSNASNTSSSAEGIKTPPPMPSMLHSPPLVP 158 >SB_7296| Best HMM Match : PHD (HMM E-Value=0.0013) Length = 873 Score = 28.3 bits (60), Expect = 1.3 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 253 SRSAESIRTPPQMRCSSRSEPYLP 182 S SAE I TPPQM+ S P P Sbjct: 472 SSSAEGINTPPQMQSMLYSPPIFP 495 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 1.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGAL 205 CGY Y+ H + F+G + +GH +KCGAL Sbjct: 71 CGYEYDG--HENQCLPRIFKGRRERTGHHKKCGAL 103 >SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALR 202 CGY Y+ R SP FQGP R ++ G +R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 42 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALR 202 CGY Y+ R SP FQGP R ++ G +R Sbjct: 82 CGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 115 >SB_41893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 1.8 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 4/76 (5%) Frame = -1 Query: 255 FQGPQRVSGHRRKCGALRVPNHISLL*DSMERERSG--RKENXXXXXXXRLXATLGYPV- 85 F+G + +GH +KCGAL P+ L S + S RKEN RL L Y + Sbjct: 15 FKGRRERTGHHKKCGAL--PSIKPYLQASRFQGESSLKRKENSSQGPRQRLRVRLRYRIC 72 Query: 84 -EHSFLKTRERLLKRF 40 E + + +L RF Sbjct: 73 RERQYPRPGSGILTRF 88 >SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALR 202 CGY Y+ R SP FQGP R ++ G +R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 42 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALR 202 CGY Y+ R SP FQGP R ++ G +R Sbjct: 120 CGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 153 >SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALR 202 CGY Y+ R SP FQGP R ++ G +R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSRAHRTPQETGRMR 42 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 27.5 bits (58), Expect = 2.4 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +3 Query: 9 NPVPIPEPGSGTVSIIVPSSLKTSVRRGNPKWXEDAAERSGKSFLFCLSVRVPWNP--IE 182 NP+P+P+ SG V + +L T V + ++ SG + + W P +E Sbjct: 351 NPLPLPQHDSGVVQVSCGRTLMTGVTANGRMILWEGSKSSGLMSSGGKNEKTVWVPRFLE 410 Query: 183 GRYG 194 G+ G Sbjct: 411 GQSG 414 >SB_58033| Best HMM Match : HSA (HMM E-Value=3.2) Length = 249 Score = 27.1 bits (57), Expect = 3.1 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -1 Query: 111 LXATLGYPVEHSFLKTRERLLKRFRCRVP 25 L TLGYP H+FL+ R R+L +R P Sbjct: 41 LSGTLGYPALHTFLE-RFRVLDLYRSYSP 68 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 38 RNRFNNRSLVFKNECSTG 91 R+ NNRS+VF EC TG Sbjct: 53 RSYHNNRSVVFLGECMTG 70 >SB_105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2982 Score = 26.6 bits (56), Expect = 4.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 205 SRSEPYLPSIGFHGTRTLRQKRKLFPDL 122 S P+ P G HG RT R + FP L Sbjct: 1175 SLGHPHPPLAGLHGARTSRPEDHRFPTL 1202 >SB_59167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALR 202 CGY Y+ R SP F+GP R ++ G +R Sbjct: 9 CGYEYDRTRKSM--SSPNFRGPSRAHRTPQETGRMR 42 >SB_48576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 26.2 bits (55), Expect = 5.4 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALRVPNH 190 CGY Y+ R SP FQGP R HR G H Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR--AHRTPQGVWCFTEH 44 >SB_20253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 26.2 bits (55), Expect = 5.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP+FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPDFQGPSR 30 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 25.8 bits (54), Expect = 7.2 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGAL 205 CGY Y+ R SP FQGP R HR AL Sbjct: 210 CGYEYDRTRKSM--SSPNFQGPSR--AHRTPQEAL 240 >SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1681 Score = 25.8 bits (54), Expect = 7.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 25 RNPAAEPFQ*SFPRL*KRVFDGVTQSGXKTPPRGPGR 135 R P AEP + + P+L +R+ DG Q + PRG R Sbjct: 200 RTPRAEPRE-ARPKLSERLDDGRDQKTMRLLPRGTPR 235 >SB_42957| Best HMM Match : TSP_1 (HMM E-Value=6.1e-13) Length = 649 Score = 25.8 bits (54), Expect = 7.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHR 223 CG+G + +PSP+F G V H+ Sbjct: 405 CGFGVQHRVRTCTNPSPQFGGKDCVGTHK 433 >SB_23929| Best HMM Match : PT (HMM E-Value=0.21) Length = 125 Score = 25.8 bits (54), Expect = 7.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 18 PIPEPGSGTVSIIVPSSLKTSVRRGNPKWXEDAAERSGKSFLFC 149 P+ +P S VS P S T PKW + + GK+F FC Sbjct: 22 PVSQPVSQPVS--QPVSRATPRPHSAPKWRLNTSTEQGKNF-FC 62 >SB_14707| Best HMM Match : A_deamin (HMM E-Value=0) Length = 1243 Score = 25.8 bits (54), Expect = 7.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -1 Query: 267 PSPEFQGPQRVSGHRRKCGALRVPNHISLL*DSMERER 154 PSP F+GPQ S R A+ N +S L + ++ R Sbjct: 738 PSPRFEGPQMQSLSREAYAAIN-KNPVSALNEYAQKNR 774 >SB_8277| Best HMM Match : DUF827 (HMM E-Value=1.7) Length = 208 Score = 25.8 bits (54), Expect = 7.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 25 RNPAAEPFQ*SFPRL*KRVFDGVTQSGXKTPPRGPGR 135 R P AEP + + P+L +R+ DG Q + PRG R Sbjct: 162 RTPRAEPRE-ARPKLSERLDDGRDQKKMRLLPRGTPR 197 >SB_1587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 201 REEHRICGGVRILSADLEIQVRDVRGDVAPVRTHIR 308 R+E ++ G + +D+++ V VRG PVR + R Sbjct: 935 RKERKVVGTQNLTISDVKLLVNIVRGLDIPVRNNAR 970 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 25.8 bits (54), Expect = 7.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 25 RNPAAEPFQ*SFPRL*KRVFDGVTQSGXKTPPRGPGR 135 R P AEP + + P+L +R+ DG Q + PRG R Sbjct: 412 RTPRAEPRE-ARPKLSERLDDGRDQKKMRLLPRGTPR 447 >SB_47352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCG 211 CGY Y+ R SP FQGP R + G Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSRAHRDTTRSG 39 >SB_46792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRR 220 CGY Y+ R SP FQG + +GH + Sbjct: 9 CGYEYDRTRKSM--SSPNFQGRRERTGHHK 36 >SB_42469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 25.8 bits (54), Expect = 7.2 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGAL-RVPNHIS 184 CGY Y+ R SP FQGP R + + L R N IS Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSRAHRNTTRSVVLYRALNPIS 49 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.8 bits (54), Expect = 7.2 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQRVSGHRRKCGALRVPNHISL 181 CGY Y+ R SP FQGP R HR H++L Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR--AHRTPQEVWCFTEHLTL 98 >SB_4740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 37 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP+FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPKFQGPSR 30 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 109 CGYEYDRTRKSM--SSPNFQGPSR 130 >SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 109 CGYEYDRTRKSM--SSPNFQGPSR 130 >SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_47799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_44329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 25.4 bits (53), Expect = 9.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 177 IEGRYGSEREEHRICGGVRI 236 +EGRYG E + I GG RI Sbjct: 30 LEGRYGKADEPYAIRGGSRI 49 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 144 CGYEYDRTRKSM--SSPNFQGPSR 165 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 72 CGYEYDRTRKSM--SSPNFQGPSR 93 >SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 66 CGYEYDRTRKSM--SSPNFQGPSR 87 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 72 CGYEYDRTRKSM--SSPNFQGPSR 93 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 43 CGYEYDRTRKSM--SSPNFQGPSR 64 >SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 26 CGYEYDRTRKSM--SSPNFQGPSR 47 >SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 144 CGYEYDRTRKSM--SSPNFQGPSR 165 >SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 72 CGYEYDRTRKSM--SSPNFQGPSR 93 >SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 144 CGYEYDRTRKSM--SSPNFQGPSR 165 >SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 47 CGYEYDRTRKSM--SSPNFQGPSR 68 >SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 60 CGYEYDRTRKSM--SSPNFQGPSR 81 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 78 CGYEYDRTRKSM--SSPNFQGPSR 99 >SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 72 CGYEYDRTRKSM--SSPNFQGPSR 93 >SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 71 CGYEYDRTRKSM--SSPNFQGPSR 92 >SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 >SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 309 CGYGYEPARHLHVHPSPEFQGPQR 238 CGY Y+ R SP FQGP R Sbjct: 9 CGYEYDRTRKSM--SSPNFQGPSR 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,487,693 Number of Sequences: 59808 Number of extensions: 198765 Number of successful extensions: 1240 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1239 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 389827759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -