BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1108 (662 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0370 + 3275771-3275789,3275972-3276976,3277062-3277624 29 2.5 04_04_0867 + 28865857-28866657,28866778-28867113,28867248-288674... 29 4.4 08_01_0535 - 4638954-4639127,4639894-4639944,4640287-4640352,464... 28 7.6 03_06_0576 + 34832900-34832911,34833006-34833122,34833752-348338... 28 7.6 >08_01_0370 + 3275771-3275789,3275972-3276976,3277062-3277624 Length = 528 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 350 F*HCACVWLEFYRFVGTCCV*VNMCPLFRTDVRVDGDYA 466 F +CA L YR G+ + N+C +F T + V+G YA Sbjct: 388 FMYCAIPALFLYRTYGSMSIMWNICLMFITGMFVNGPYA 426 >04_04_0867 + 28865857-28866657,28866778-28867113,28867248-28867451, 28867567-28867746 Length = 506 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 463 VIPIYTDISTKQRTHIYLHTTCPYESVKFEPNTRTVLKTNDNSIG 329 ++ +T++S K RT L TC Y N +LKTN + G Sbjct: 52 LLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILKTNFANYG 96 >08_01_0535 - 4638954-4639127,4639894-4639944,4640287-4640352, 4640492-4640557,4640701-4640892,4641282-4641780, 4642009-4642364 Length = 467 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -1 Query: 479 YINSERNPHLHGHQYETTDTYLLTHNMSLRIGKIRAKHTH 360 Y++S RN H H + +T L N S G + +H H Sbjct: 127 YMSSSRNDHHTNHHHHQINTPSLMSNSSSNNGVMLQEHQH 166 >03_06_0576 + 34832900-34832911,34833006-34833122,34833752-34833810, 34833901-34833960,34834197-34834250,34834332-34834380, 34834493-34834540,34834889-34834954,34835591-34835641, 34835732-34835851,34835921-34836005,34836428-34836509, 34836666-34836774,34837005-34837051,34837131-34837188, 34839114-34839220,34839700-34839765,34839833-34839879, 34839977-34840042,34840146-34840243,34840344-34840469, 34840551-34840835,34840920-34840985,34841079-34841228 Length = 675 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 421 HIYLHTTCPYESVKFEPNTRTVL 353 H +H T PY+++ F+P RT+L Sbjct: 479 HANVHGTLPYDNLHFDPVLRTLL 501 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,952,629 Number of Sequences: 37544 Number of extensions: 256574 Number of successful extensions: 583 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -