BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1108 (662 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC033509-1|AAH33509.1| 283|Homo sapiens MDH1B protein protein. 30 8.5 AK096940-1|BAC04906.1| 226|Homo sapiens protein ( Homo sapiens ... 30 8.5 >BC033509-1|AAH33509.1| 283|Homo sapiens MDH1B protein protein. Length = 283 Score = 29.9 bits (64), Expect = 8.5 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -1 Query: 296 KKNSPRTHTTYPEVLMSWHSLI 231 + ++PRT+T +P + SWHS++ Sbjct: 255 QSDTPRTNTLHPSIQSSWHSVL 276 >AK096940-1|BAC04906.1| 226|Homo sapiens protein ( Homo sapiens cDNA FLJ39621 fis, clone SMINT2001158. ). Length = 226 Score = 29.9 bits (64), Expect = 8.5 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 536 LHSRPSTRCRPITKH*IITYINSERNPHLHGHQYETTDTYLLTHNMS 396 +HS T P+T I T + + H H H++ T T TH ++ Sbjct: 105 IHSNTPTHTHPLTSTHIQTSTVTHTHSHTHAHKHTYTHTSTHTHPLT 151 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,149,954 Number of Sequences: 237096 Number of extensions: 1437034 Number of successful extensions: 6199 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6196 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7478817430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -