BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1108 (662 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 4.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 4.5 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 6.0 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 604 YNNNHNHTKH*GYYIECYCTVKLYIHVPAH 515 YNNN+N+ K Y I + + + VP + Sbjct: 96 YNNNNNYNKKLYYNINYIEQIPVPVPVPIY 125 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 604 YNNNHNHTKH*GYYIECYCTVKLYIHVPAH 515 YNNN+N+ K Y I + + + VP + Sbjct: 334 YNNNNNYNKKLYYNINYIEQIPVPVPVPIY 363 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 604 YNNNHNHTKH 575 YN+NHN +H Sbjct: 425 YNHNHNQARH 434 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,116 Number of Sequences: 438 Number of extensions: 3285 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -