BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1107 (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.5 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.3 At5g42370.1 68418.m05159 expressed protein 29 4.3 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 4.3 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 5.7 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.7 At1g12370.2 68414.m01430 type II CPD photolyase PHR1 (PHR1) near... 28 5.7 At1g12370.1 68414.m01429 type II CPD photolyase PHR1 (PHR1) near... 28 5.7 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 7.6 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 7.6 At5g60000.1 68418.m07524 hypothetical protein 27 10.0 At5g22390.1 68418.m02612 expressed protein 27 10.0 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 458 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 363 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 245 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 111 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 184 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 74 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 47 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 178 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 589 RVRIQSET*DDFRECHIKYIQFLRPH 512 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 240 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 142 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At1g12370.2 68414.m01430 type II CPD photolyase PHR1 (PHR1) nearly identical to type II CPD photolyase PHR1 [Arabidopsis thaliana] GI:2984707; similar to class II DNA photolyase (GI:5081541) [Chlamydomonas reinhardtii]; supporting cDNA gi|2984706|gb|AF053365.1|AF053365 Length = 496 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -3 Query: 725 RQSDSLV-RASSELTV-ERRSYRIVPMRTKRNRHDFTARKIRGRPENAGPD 579 R D +V R S L + E ++ +VPM ++ +++AR IRG+ PD Sbjct: 134 RCKDEVVKRTSDSLAIHEVDAHNVVPMWAASSKLEYSARTIRGKINKLLPD 184 >At1g12370.1 68414.m01429 type II CPD photolyase PHR1 (PHR1) nearly identical to type II CPD photolyase PHR1 [Arabidopsis thaliana] GI:2984707; similar to class II DNA photolyase (GI:5081541) [Chlamydomonas reinhardtii]; supporting cDNA gi|2984706|gb|AF053365.1|AF053365 Length = 490 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -3 Query: 725 RQSDSLV-RASSELTV-ERRSYRIVPMRTKRNRHDFTARKIRGRPENAGPD 579 R D +V R S L + E ++ +VPM ++ +++AR IRG+ PD Sbjct: 134 RCKDEVVKRTSDSLAIHEVDAHNVVPMWAASSKLEYSARTIRGKINKLLPD 184 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 467 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 348 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 467 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 348 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g60000.1 68418.m07524 hypothetical protein Length = 149 Score = 27.5 bits (58), Expect = 10.0 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -1 Query: 334 RGSSPWRPAADMGTNRRDISTYIPHLNFKVRREYPD-TAANAVLFAFRTISPFYRIPWNS 158 +GS PW+P +GT R+ + + + D T + F FYR WN+ Sbjct: 78 QGSRPWQPRTCIGTFYREAHFGMHETPYVLYNSDKDATESKNSCFVVVKDDGFYR--WNN 135 Query: 157 NAQAEKKTLP 128 N + K P Sbjct: 136 NKRIWDKVFP 145 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 119 ERSGKSFLFCLSVRVPWNPIEG 184 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,406,514 Number of Sequences: 28952 Number of extensions: 388139 Number of successful extensions: 1147 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -