BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1106 (653 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377... 28 7.5 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 7.5 02_05_0602 + 30283893-30284170,30286259-30286305,30286534-302875... 27 9.9 >11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840, 3778828-3778898,3778975-3779213,3779306-3779383, 3779734-3780156,3780416-3780661,3780886-3780978, 3781480-3781527 Length = 571 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 280 KSIVGTGYRGERLIEPSSSWFRPKFPSG 363 + + GTG + PSS+WF P+ SG Sbjct: 12 RCVFGTGPLPPASLSPSSAWFDPELSSG 39 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 7.5 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 461 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 300 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 >02_05_0602 + 30283893-30284170,30286259-30286305,30286534-30287510, 30287611-30287920,30288561-30290197 Length = 1082 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 190 KCWDPKDGELCLVRSKSGETLMRTVAILTCKSIVGTGYRGERLIEPSSSW 339 KC+ P + L ++R T A+ S+V +RG ++E SSW Sbjct: 672 KCFMPDELNLSIIRVLLALTA-HAKALAAVVSVVRENHRGHSIVELMSSW 720 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,126,229 Number of Sequences: 37544 Number of extensions: 394688 Number of successful extensions: 808 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -