BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1103 (714 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.3 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 1.8 At1g76965.1 68414.m08961 glycine-rich protein 29 2.3 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.0 At5g42370.1 68418.m05159 expressed protein 29 4.0 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 4.0 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 5.3 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.3 At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s... 28 7.1 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 7.1 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 7.1 At5g60000.1 68418.m07524 hypothetical protein 27 9.3 At5g22390.1 68418.m02612 expressed protein 27 9.3 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 582 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 698 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 565 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 699 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 458 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 363 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 245 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 111 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 184 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 74 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 47 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 178 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 589 RVRIQSET*DDFRECHIKYIQFLRPH 512 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 240 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 142 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g22740.1 68418.m02656 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 534 Score = 27.9 bits (59), Expect = 7.1 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +1 Query: 517 ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 681 ASK + I Y RENR+ ++ G+ GL R + V+ C + + D P F Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 467 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 348 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 467 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 348 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g60000.1 68418.m07524 hypothetical protein Length = 149 Score = 27.5 bits (58), Expect = 9.3 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -3 Query: 334 RGSSPWRPAADMGTNRRDISTYIPHLNFKVRREYPD-TAANAVLFAFRTISPFYRIPWNS 158 +GS PW+P +GT R+ + + + D T + F FYR WN+ Sbjct: 78 QGSRPWQPRTCIGTFYREAHFGMHETPYVLYNSDKDATESKNSCFVVVKDDGFYR--WNN 135 Query: 157 NAQAEKKTLP 128 N + K P Sbjct: 136 NKRIWDKVFP 145 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 119 ERSGKSFLFCLSVRVPWNPIEG 184 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,804,498 Number of Sequences: 28952 Number of extensions: 376939 Number of successful extensions: 1082 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1082 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -