BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1100 (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 25 2.0 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 25 2.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 6.0 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 23 7.9 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 23 7.9 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 23 7.9 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 7.9 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 25.4 bits (53), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 563 NLKRLHTSLGLPHCPHCLQFAEIKEKVD 480 NL R H +GL +QF+E+ + V+ Sbjct: 112 NLPRFHNDIGLVRLEQPVQFSELVQSVE 139 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 25.4 bits (53), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 563 NLKRLHTSLGLPHCPHCLQFAEIKEKVD 480 NL R H +GL +QF+E+ + V+ Sbjct: 112 NLPRFHNDIGLVRLEQPVQFSELVQSVE 139 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 6.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 433 LEMQPLSTWYLPSLYV*SP 377 LE PL++W LP YV P Sbjct: 632 LEPVPLASWQLPPPYVTEP 650 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 7.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -2 Query: 163 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 29 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 7.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -2 Query: 163 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 29 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 7.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -2 Query: 163 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 29 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.4 bits (48), Expect = 7.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -2 Query: 163 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 29 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 69 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 824,899 Number of Sequences: 2352 Number of extensions: 17432 Number of successful extensions: 57 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -