BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1098 (726 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical pr... 31 0.63 Z68213-1|CAA92435.2| 487|Caenorhabditis elegans Hypothetical pr... 29 4.5 U41026-1|AAM51522.2| 101|Caenorhabditis elegans Hypothetical pr... 29 4.5 Z75714-11|CAB00063.2| 723|Caenorhabditis elegans Hypothetical p... 28 5.9 Z75714-10|CAN99711.1| 721|Caenorhabditis elegans Hypothetical p... 28 5.9 Z68882-17|CAI79150.1| 111|Caenorhabditis elegans Hypothetical p... 28 5.9 AF024500-4|AAB70365.1| 335|Caenorhabditis elegans Hypothetical ... 28 7.8 >U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical protein T26C11.2 protein. Length = 343 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +2 Query: 407 EPTPK-ESEPFKSVVPDNKPFGYPFDRPV 490 +PTPK +SEPF +P +KP PF P+ Sbjct: 7 KPTPKPKSEPFPKPMPKSKPKSEPFPSPM 35 >Z68213-1|CAA92435.2| 487|Caenorhabditis elegans Hypothetical protein C01F6.2 protein. Length = 487 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 413 TPKESEPFKSVVPDNKPFGYPFDRPVLPQ 499 TPK + + VP N+P F RPV+P+ Sbjct: 128 TPKTPDVIRQKVPMNEPVNCVFIRPVIPK 156 >U41026-1|AAM51522.2| 101|Caenorhabditis elegans Hypothetical protein C28G1.5 protein. Length = 101 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 596 IKRNYNALIRKSKRTLTITVYNSRISCEYVKTVANVINKN 715 I RN + +T V NS + C + +TV N++N + Sbjct: 21 IPRNLTCGHALCHKCITAMVNNSTVECPFCRTVTNIVNND 60 >Z75714-11|CAB00063.2| 723|Caenorhabditis elegans Hypothetical protein ZC434.6b protein. Length = 723 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 503 FKNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 664 FKNL W++ YS Y L ++ I+R+ + ++ SK I +YNS Sbjct: 67 FKNLDSC----WNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLYNS 116 >Z75714-10|CAN99711.1| 721|Caenorhabditis elegans Hypothetical protein ZC434.6a protein. Length = 721 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 503 FKNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 664 FKNL W++ YS Y L ++ I+R+ + ++ SK I +YNS Sbjct: 67 FKNLDSC----WNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLYNS 116 >Z68882-17|CAI79150.1| 111|Caenorhabditis elegans Hypothetical protein C47E12.14 protein. Length = 111 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 626 KSKRTLTITVYNSRISCEYVKTVANVINK 712 KSK TL ++ +R+S ++VKT NV +K Sbjct: 58 KSKFTLAQPIFKNRMSADFVKTHKNVGSK 86 >AF024500-4|AAB70365.1| 335|Caenorhabditis elegans Hypothetical protein K06H6.6 protein. Length = 335 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 538 VYHEGELFPYLFNIPHYTPDK 600 VY G L PY + +PH+TP K Sbjct: 302 VYRNGGLNPYDYYLPHWTPLK 322 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,442,534 Number of Sequences: 27780 Number of extensions: 318677 Number of successful extensions: 967 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 966 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -