BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1098 (726 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 31 0.59 At5g64270.1 68418.m08074 splicing factor, putative similar to sp... 30 1.4 At5g57160.1 68418.m07140 DNA ligase IV identical to DNA ligase I... 28 7.2 At1g64260.1 68414.m07281 zinc finger protein-related contains Pf... 27 9.6 At1g48570.1 68414.m05431 zinc finger (Ran-binding) family protei... 27 9.6 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 31.5 bits (68), Expect = 0.59 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 422 P*VSVHTDRRNTMEYCYKLWVGNGQDIVKKYFPLSF 315 P + V T N EY KL + +G D KYFPL+F Sbjct: 384 PLIVVDTKNLNC-EYQLKLMIASGVDAANKYFPLAF 418 >At5g64270.1 68418.m08074 splicing factor, putative similar to splicing factor 3B subunit 1 (Spliceosome associated protein 155) (SAP 155) (SF3b155) (Pre-mRNA splicing factor SF3b 155 kDa subunit) (146 kDa nuclear protein) SP:O57683 from [Xenopus laevis] Length = 1269 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = +2 Query: 347 PVRCRPTACSSTPWCFVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKNL 514 P+R TP P P+E+ + VP P G PF +P QYF +L Sbjct: 387 PIRTPARKLQQTPTPMATPGYVIPEENRGQQYDVPPEVPGGLPFMKPEDYQYFGSL 442 >At5g57160.1 68418.m07140 DNA ligase IV identical to DNA ligase IV GI:9651815 from [Arabidopsis thaliana]; identical to cDNA DNA ligase IV, GI:9651814 Length = 1219 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/65 (26%), Positives = 34/65 (52%) Frame = +2 Query: 485 PVLPQYFKNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 664 P+LP+YF +LT +SR + +S Y L + +K+ + ++S+ + +I Y Sbjct: 733 PLLPKYFLHLTDASRTKLQDDIDEFSDSYYWDLDLEGLKQVLSN-AKQSEDSKSIDYYKK 791 Query: 665 RISCE 679 ++ E Sbjct: 792 KLCPE 796 >At1g64260.1 68414.m07281 zinc finger protein-related contains Pfam profiles PF03108: MuDR family transposase, PF04434: SWIM zinc finger Length = 719 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 422 P*VSVHTDRRNTMEYCYKLWVGNGQDIVKKYFPLSF 315 P + V T N +Y KL + +G D K+FPL+F Sbjct: 377 PLIVVDTKSLNG-KYQLKLMIASGVDAANKFFPLAF 411 >At1g48570.1 68414.m05431 zinc finger (Ran-binding) family protein contains Pfam domain, PF00641: Zn-finger in Ran binding protein and others Length = 455 Score = 27.5 bits (58), Expect = 9.6 Identities = 19/77 (24%), Positives = 37/77 (48%) Frame = -1 Query: 264 PRSELGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFKAHNTKYNQYLKMSTS 85 P+ ++ PS ER A+ D+ ++ V++K + RV FK+ N + + + + Sbjct: 229 PKPSSKESSLPSKER-AFKSRNDEPSQRVAFKSRNDDPSQRVAFKSRNDEPSHRVAFKSR 287 Query: 84 TCNCNARDRVVYGGNSA 34 + RDR +Y + A Sbjct: 288 NDESSQRDRPLYSADWA 304 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,445,262 Number of Sequences: 28952 Number of extensions: 292274 Number of successful extensions: 825 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1584903024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -