BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1097 (776 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.74 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 27 3.0 SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc... 26 5.2 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 6.9 SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|c... 26 6.9 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 9.2 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.74 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 377 SGCGRCRVWSMFVRYVRFSE 436 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 27.1 bits (57), Expect = 3.0 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -1 Query: 248 ADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISL 120 A GT++ +IST +P P++VSGH A R+P+ S+ Sbjct: 371 ATNGTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412 >SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1014 Score = 26.2 bits (55), Expect = 5.2 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -3 Query: 396 RHRPHPLPVQTRHAPV-LRANPYSEVTDPICRLPLPTLFYRLEALHLGACCGYGYEPAR 223 RH P++T P+ + P E+ I R P L + L++ ACC YG P + Sbjct: 478 RHIKDQRPLKTGEGPIAIIMTPTRELAVQIFRECKPFL----KLLNIRACCAYGGAPIK 532 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.9 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 156 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 19 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 25.8 bits (54), Expect = 6.9 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 423 FVLAS*YFNIMRPQKLYIFNMTLAKIVLRSD 515 F + S ++ ++P L + +M++A IVLR+D Sbjct: 255 FPIQSTFYKDVKPFDLKLLHMSVASIVLRND 285 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 9.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 414 TNIDQTRHRPHPLPVQTRHAPV 349 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,302,990 Number of Sequences: 5004 Number of extensions: 70629 Number of successful extensions: 201 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -