BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1097 (776 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 31 1.1 At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.5 At1g76965.1 68414.m08961 glycine-rich protein 29 2.6 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 3.4 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 3.4 At1g21570.1 68414.m02697 zinc finger (CCCH-type) family protein ... 29 3.4 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.5 At5g42370.1 68418.m05159 expressed protein 29 4.5 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 6.0 At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP1... 28 7.9 At2g19150.1 68415.m02235 pectinesterase family protein contains ... 28 7.9 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 493 RKSSYVRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 639 R ++YV T SG R++L+ R+ D HD + PFNG T Sbjct: 176 RNNTYV-TQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 522 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 638 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 398 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 303 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -1 Query: 464 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 288 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -1 Query: 464 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 288 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At1g21570.1 68414.m02697 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 470 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = -3 Query: 393 HRPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALHLGACCGYGYEPARHLH 214 H P + V T+ L AN ++T + +P Y L+ L C Y RH+H Sbjct: 266 HDPSKIAVCTKFLNGLCANANCKLTHKVIPERMPDCSYYLQGLCNNEACPY-----RHVH 320 Query: 213 VHP 205 V+P Sbjct: 321 VNP 323 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 185 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 51 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 124 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 14 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 180 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 82 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 964 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +3 Query: 180 LRTLKIQVRDVRGDVAPVRTHIRSRLQGEEPLVDRIM*VREVGKLDP*LRNKD 338 ++ LK ++DVRGD + S+ Q E + + + GKLDP + D Sbjct: 214 IQVLKDAIKDVRGDQRVTDRNPESKYQALEKYGNDLTEMARRGKLDPVIGRDD 266 >At2g19150.1 68415.m02235 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 339 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 155 ICGGVRILSADLENSGEGCTWRCRAGSYP 241 I GG+ + ++ EGCT + R G YP Sbjct: 185 ISGGIDFIFGGAQSIFEGCTLKLRVGIYP 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,854,206 Number of Sequences: 28952 Number of extensions: 397208 Number of successful extensions: 1076 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1076 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -