BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1092 (768 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 4.7 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 4.7 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 4.7 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 242 GRWPWKSESAKECATTHLPKQPAL 171 GR WK + AT L K P+L Sbjct: 79 GRKAWKHLDFRNSATAELLKNPSL 102 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 242 GRWPWKSESAKECATTHLPKQPAL 171 GR WK + AT L K P+L Sbjct: 79 GRKAWKHLDFRNSATAELLKNPSL 102 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/40 (22%), Positives = 21/40 (52%) Frame = -1 Query: 342 VSRTGAVG*TKRSVKAPKKRSWDTMKGVGPHDSRTVAMEV 223 ++ V T + ++ PK+++W + P + +V+ EV Sbjct: 88 LNNNNVVSSTNQEIRGPKRKTWKVEED-SPSPTSSVSPEV 126 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,359 Number of Sequences: 336 Number of extensions: 4370 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -