BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1092 (768 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 4e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 9e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 45 8e-05 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 35 0.083 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 30 1.8 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 30 1.8 SB_24532| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.5 bits (170), Expect = 3e-13 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -2 Query: 257 VLMTAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 V TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 77 VAETAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -2 Query: 248 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -2 Query: 248 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -2 Query: 248 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -2 Query: 227 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -2 Query: 227 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -2 Query: 227 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 52.0 bits (119), Expect = 5e-07 Identities = 32/67 (47%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = -2 Query: 320 DEPNVVLRRLKNAHGTP*KALVL---MTAGRWPWKSESAKECATTHLPKQPALKMDGAEA 150 DEPN LR P K + G W AKEC TTHLPKQ ALKMDGA+A Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNP--AKECVTTHLPKQLALKMDGAQA 60 Query: 149 FCLYTTV 129 LY V Sbjct: 61 SHLYRAV 67 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -2 Query: 221 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 129 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFKV 423 LN FGSS ASSAYQ WPT + H +SGF SR+S+ FKV Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -2 Query: 218 SAKECATTHLPKQPALKMDGAEAFCLYTTV 129 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -2 Query: 218 SAKECATTHLPKQPALKMDGAEAFCLYTTV 129 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -2 Query: 218 SAKECATTHLPKQPALKMDGAEAFCLYTTV 129 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -2 Query: 218 SAKECATTHLPKQPALKMDGAEAFCLYTTV 129 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +1 Query: 232 GHRPAVMRTNAFHGVP*AFFRRLNTTFGSSHSASSAYQNWPTWHRHQISGF 384 GH + F G LN FGSS ASSAYQ WPT + H +SGF Sbjct: 33 GHHKKCEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +3 Query: 609 NRYGPPSGFPLTST*PGIVHHLSGPSICA 695 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.0 bits (104), Expect = 3e-05 Identities = 30/67 (44%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = -2 Query: 320 DEPNVVLRRLKNAHGTP*KALVL---MTAGRWPWKSESAKECATTHLPKQPALKMDGAEA 150 DEPN LR P K + G W KEC TT LPKQ ALKMDGA+A Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNP--LKECVTTPLPKQLALKMDGAQA 60 Query: 149 FCLYTTV 129 LY V Sbjct: 61 SHLYRAV 67 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 45.6 bits (103), Expect = 4e-05 Identities = 27/79 (34%), Positives = 37/79 (46%) Frame = +1 Query: 148 NASAPSIFRAGCFGR*VVAHSLADSDFHGHRPAVMRTNAFHGVP*AFFRRLNTTFGSSHS 327 ++S P + + R + +L F G + + F G LN FGSS Sbjct: 7 SSSVPLVGASHLLRRHGIGATLERHPFSGLVASAEQPTPFVGSDERRLWHLNRAFGSSRI 66 Query: 328 ASSAYQNWPTWHRHQISGF 384 ASSAYQ WPT + H +SGF Sbjct: 67 ASSAYQKWPTRNSHSLSGF 85 Score = 34.7 bits (76), Expect = 0.083 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 140 IGKTLQRHPFSGLVASA 190 IG TL+RHPFSGLVASA Sbjct: 24 IGATLERHPFSGLVASA 40 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 54 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 55 LNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 Score = 34.7 bits (76), Expect = 0.083 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 140 IGKTLQRHPFSGLVASA 190 IG TL+RHPFSGLVASA Sbjct: 22 IGATLERHPFSGLVASA 38 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 96 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ WPT + H +SGF Sbjct: 17 LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN +GSS ASSAYQ WPT + H +SGF Sbjct: 17 LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +2 Query: 608 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 697 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSA Q WPT + H +SGF Sbjct: 74 LNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 227 KSESAKECATTHLPKQPALKM 165 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQISGF 384 LN FGSS ASSAYQ PT + H +SGF Sbjct: 17 LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPTWHRHQI 375 LN FGSS ASSAYQ WPT + H + Sbjct: 17 LNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.048 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWPT 357 LN FGSS ASSAYQ WPT Sbjct: 17 LNRAFGSSRIASSAYQKWPT 36 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 34.7 bits (76), Expect = 0.083 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 247 QQDGGHGSRNPLRSVQRL 194 QQDGGHGS NPLR QRL Sbjct: 28 QQDGGHGSWNPLRKGQRL 45 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 609 NRYGPPSGFPLTST*PGIVHH 671 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 559 ISLSPLYPVPTIDLHVR 609 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +1 Query: 298 LNTTFGSSHSASSAYQNWP 354 LN FGSS ASSAYQN P Sbjct: 17 LNRAFGSSRIASSAYQNGP 35 Score = 28.3 bits (60), Expect = 7.2 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +2 Query: 257 PTPFMVSHERFLGALTLRLVHPTAPVLLTKIGPLGTVIRSPAS 385 PTPF+ S ER L L + GPLGT I PAS Sbjct: 3 PTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = -1 Query: 741 LPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDRSDSDVQID 592 L RR VSN + +++H+ + +DG+ V++K G++L++ D+DV ++ Sbjct: 29 LARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVAKDNDVDLE 82 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +1 Query: 310 FGSSHSASSAYQNWPTWHRHQISGF 384 FGSS ASS YQN PT R GF Sbjct: 78 FGSSRIASSGYQNGPTRTRIHCPGF 102 Score = 29.9 bits (64), Expect = 2.4 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = +2 Query: 257 PTPFMVSHERFLGALTLRLVHPTAPVLLTKI-------GPLGTVIRSPASSFE*AGVLTH 415 PTPF+ S ER RL HP ++I GP T I P + + G+LT+ Sbjct: 60 PTPFVGSDER-------RLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTN 111 Query: 416 LKFENR 433 LKFENR Sbjct: 112 LKFENR 117 >SB_24532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 258 GPHDSRTVAMEVGIR 214 G DSRTVAMEVGIR Sbjct: 21 GSPDSRTVAMEVGIR 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,076,908 Number of Sequences: 59808 Number of extensions: 584118 Number of successful extensions: 1374 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1372 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -