BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1092 (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 4.5 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 7.9 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.2 bits (50), Expect = 4.5 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 748 FRTPEASRFQSVNEGAL*AQMLGPERW*TM-PGQVEVRGNPD 626 + T E +SV G +LGP W TM G +++ PD Sbjct: 611 YETSEGPVVRSVTAGVPQGSILGPTLWNTMYDGVLDIALPPD 652 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.4 bits (48), Expect = 7.9 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = -2 Query: 86 AVTSRTC-ATESAEGSGREPAWS 21 A TS C A GSG EP WS Sbjct: 19 AGTSSCCPAGTGLNGSGTEPGWS 41 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 864,763 Number of Sequences: 2352 Number of extensions: 19400 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -