BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbVm1092
(768 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AL032644-1|CAA21666.2| 604|Caenorhabditis elegans Hypothetical ... 28 8.4
>AL032644-1|CAA21666.2| 604|Caenorhabditis elegans Hypothetical
protein Y51H1A.2 protein.
Length = 604
Score = 27.9 bits (59), Expect = 8.4
Identities = 15/51 (29%), Positives = 25/51 (49%)
Frame = +2
Query: 488 VLKFYIDPAILRETSDGTSY*MVRLVFRPYTQFRRSICTSESLRSSIRVSP 640
+ +FY D A LR SDG +R + +P + S T+ S ++ +P
Sbjct: 150 IQQFYSDDAFLRLLSDGDQSERIRGLLKPLSSLPISAATNSSFLNTWTPTP 200
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,818,814
Number of Sequences: 27780
Number of extensions: 425188
Number of successful extensions: 910
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 880
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 910
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1840614650
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -