BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1092 (768 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 32 0.48 At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) ... 31 0.85 At1g74690.1 68414.m08650 calmodulin-binding family protein low s... 29 2.6 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 29 4.5 At3g21150.1 68416.m02672 zinc finger (B-box type) family protein... 28 7.9 At2g35890.1 68415.m04406 calcium-dependent protein kinase, putat... 28 7.9 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -2 Query: 131 VTGTCDAKFLIW-YH*AVTSRTCATESAEGSG 39 VTG+ D+ L+W H A TSRT +E + GSG Sbjct: 2684 VTGSRDSTVLLWRIHKAFTSRTSVSEPSTGSG 2715 >At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) similar to GI:11993492; RNA binding protein - Homo sapiens, EMBL:AB016089 (N-terminus), several ubiquitin carboxyl-terminal hydrolases from aa pos. 712 Length = 1067 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 663 LCLVRSKSGETLMEDRSDSDVQIDRRNWV*GRKTN 559 +C VR K M + SDS ++DRR R+TN Sbjct: 928 VCFVRGKEAPKAMLEASDSSFEVDRRTSKRSRRTN 962 >At1g74690.1 68414.m08650 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 587 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 353 PLGTVIRSPASSFE*AGVLTHLKFENRLRSFR 448 P +V + PAS+FE + V T +FE RSFR Sbjct: 282 PKKSVRKVPASNFESSSVQTSFEFEKPKRSFR 313 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = +2 Query: 290 LGALTLRLVHPTAPVLLTKIGPLGTVIRSPASSFE*AGVLTHLKFEN 430 LG+ T R V+ + +LL + GTVIRS S+ GV H N Sbjct: 881 LGSRTERPVNVSLDMLLKLVAVFGTVIRSTVSAPRIVGVDLHANERN 927 >At3g21150.1 68416.m02672 zinc finger (B-box type) family protein contains Pfam profile:PF01760 CONSTANS family zinc finger Length = 225 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 210 LSGFRLPWPP--SCCHEDQRLSWC 275 +SG LPWPP +CC E S C Sbjct: 58 VSGPLLPWPPRTTCCSESSSSSCC 81 >At2g35890.1 68415.m04406 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK). [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 520 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 251 MTAGRWPWKSESAKECATTHLPKQPALKMDGAEAFC 144 +T+ WP SESAK+ L + P ++ + C Sbjct: 351 LTSDPWPQVSESAKDLIRKMLERNPIQRLTAQQVLC 386 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,150,131 Number of Sequences: 28952 Number of extensions: 411879 Number of successful extensions: 882 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -