BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1088 (760 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-... 31 0.83 At4g27570.1 68417.m03960 glycosyltransferase family protein cont... 30 1.5 At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.5 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 1.9 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 5.9 At5g05360.2 68418.m00577 expressed protein similar to unknown pr... 28 5.9 At5g05360.1 68418.m00578 expressed protein similar to unknown pr... 28 5.9 At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly iden... 28 5.9 At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s... 28 7.7 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 28 7.7 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 7.7 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 28 7.7 At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ... 28 7.7 >At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-binding protein GUF1 - Saccharomyces cerevisiae, PIR:S50374 Length = 661 Score = 31.1 bits (67), Expect = 0.83 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -2 Query: 684 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHV 538 LG +H PA +I+R P PP +S +++++F E +CY S V Sbjct: 231 LGLEHVLPA-VIERIPPPPG-ISESPLRMLLFDSFFNEYKGVICYVSVV 277 >At4g27570.1 68417.m03960 glycosyltransferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -2 Query: 675 KHRAPADIIDRAPLPPNRVSNETMKV-VVFQRRSRETISHLCYTSHVSLQCQTRVKLTGS 499 K P + ID P RV+ M V+ R +RE + C ++ C+ +V LTG Sbjct: 175 KKLEPTNTIDVGPNLLERVTTSLMNSDVIAIRTAREIEGNFC--DYIEKHCRKKVLLTGP 232 Query: 498 SFP 490 FP Sbjct: 233 VFP 235 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 91 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 207 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 74 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 208 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 98 RVRIQSET*DDFRECHIKYIQFLRPH 21 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At5g05360.2 68418.m00577 expressed protein similar to unknown protein (pir||T02500) Length = 153 Score = 28.3 bits (60), Expect = 5.9 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = -2 Query: 639 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLTGSSFPADSPKP---V 469 P P+R S V ++ +R+T SHL Y++ V L+ + + PA P V Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE-KAGSHSGSNPAPASGSDPINRV 78 Query: 468 PLAVVSLD 445 PLA V D Sbjct: 79 PLAQVVED 86 >At5g05360.1 68418.m00578 expressed protein similar to unknown protein (pir||T02500) Length = 163 Score = 28.3 bits (60), Expect = 5.9 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = -2 Query: 639 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLTGSSFPADSPKP---V 469 P P+R S V ++ +R+T SHL Y++ V L+ + + PA P V Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE-KAGSHSGSNPAPASGSDPINRV 78 Query: 468 PLAVVSLD 445 PLA V D Sbjct: 79 PLAQVVED 86 >At1g75780.1 68414.m08801 tubulin beta-1 chain (TUB1) nearly identical to SP|P12411 Tubulin beta-1 chain {Arabidopsis thaliana} Length = 447 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/93 (21%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Frame = +1 Query: 58 SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237 ++ SSY +WI V D+P + S ++ +R ++ + Sbjct: 336 NKNSSYFVEWIPNNVKSSVCDIPPTGIKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAF 395 Query: 238 IKTKHWMALAGVDAM*FLPSALNVN--VKKFKQ 330 + HW G+D M F + N+N V +++Q Sbjct: 396 L---HWYTGEGMDEMEFTEAESNMNDLVSEYQQ 425 >At5g22740.1 68418.m02656 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 534 Score = 27.9 bits (59), Expect = 7.7 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +2 Query: 26 ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 190 ASK + I Y RENR+ ++ G+ GL R + V+ C + + D P F Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -2 Query: 357 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGH 256 ++T V P ++ F+H I + ++ + V+ + GH Sbjct: 33 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGH 66 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 648 DRAPLPPNRVSNETMKVVVFQRRSRET 568 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -2 Query: 357 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGH 256 ++T V P ++ F+H I + ++ + V+ + GH Sbjct: 32 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGH 65 >At1g67340.1 68414.m07665 zinc finger (MYND type) family protein / F-box family protein Length = 379 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -2 Query: 699 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 562 S LC LG+ R PAD I+ L R+ M +V R S + I+ Sbjct: 54 SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,892,368 Number of Sequences: 28952 Number of extensions: 360665 Number of successful extensions: 872 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -