BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1087 (775 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase Ogm1|Schi... 32 0.079 SPCC126.08c |||lectin |Schizosaccharomyces pombe|chr 3|||Manual 27 3.9 >SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase Ogm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 893 Score = 32.3 bits (70), Expect = 0.079 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 610 NSNVKKI*DLWSVHWCQVMCVSSTTILYHLIDNTDFKIKAVGINY 744 N N+ K W +HW + + LYH + F I A+G+++ Sbjct: 611 NYNIGKFVVAWLLHWAPYILETDRVFLYHYLPALYFGIAALGVSW 655 >SPCC126.08c |||lectin |Schizosaccharomyces pombe|chr 3|||Manual Length = 312 Score = 26.6 bits (56), Expect = 3.9 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 304 LRGNEYEISFNMYSELTFTQLHSSAFKFSEGFYKCINLTECTL 432 +RGN+Y + Y + A++ S F KC +L E L Sbjct: 177 VRGNDYNLGKLKYDKNAKKLRFEIAYQGSSSFIKCFDLNEVEL 219 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,595,428 Number of Sequences: 5004 Number of extensions: 47387 Number of successful extensions: 81 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -