BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1084 (506 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42204-1|AAB50956.1| 855|Drosophila melanogaster putative potas... 28 8.3 U36925-1|AAB50936.1| 855|Drosophila melanogaster seizure potass... 28 8.3 AY058350-1|AAL13579.1| 855|Drosophila melanogaster GH12235p pro... 28 8.3 AE013599-3790|AAF47148.1| 855|Drosophila melanogaster CG3182-PB... 28 8.3 AE013599-3789|AAM68296.1| 855|Drosophila melanogaster CG3182-PA... 28 8.3 >U42204-1|AAB50956.1| 855|Drosophila melanogaster putative potassium channel subunithomolog protein. Length = 855 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 163 EIYEPNEEIIFHEIYESG*SEYRRGIPAKPKNVVEKMLYLLQ*IL*KIE 309 E+Y N I + + E++R PAK VE+ L+ L L KIE Sbjct: 23 ELYMSNNNINDNAAKKPPVKEFKRNCPAKSNKFVERELFSLMCNLNKIE 71 >U36925-1|AAB50936.1| 855|Drosophila melanogaster seizure potassium channel protein. Length = 855 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 163 EIYEPNEEIIFHEIYESG*SEYRRGIPAKPKNVVEKMLYLLQ*IL*KIE 309 E+Y N I + + E++R PAK VE+ L+ L L KIE Sbjct: 23 ELYMSNNNINDNAAKKPPVKEFKRNCPAKSNKFVERELFSLMCNLNKIE 71 >AY058350-1|AAL13579.1| 855|Drosophila melanogaster GH12235p protein. Length = 855 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 163 EIYEPNEEIIFHEIYESG*SEYRRGIPAKPKNVVEKMLYLLQ*IL*KIE 309 E+Y N I + + E++R PAK VE+ L+ L L KIE Sbjct: 23 ELYMSNNNINDNAAKKPPVKEFKRNCPAKSNKFVERELFSLMCNLNKIE 71 >AE013599-3790|AAF47148.1| 855|Drosophila melanogaster CG3182-PB, isoform B protein. Length = 855 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 163 EIYEPNEEIIFHEIYESG*SEYRRGIPAKPKNVVEKMLYLLQ*IL*KIE 309 E+Y N I + + E++R PAK VE+ L+ L L KIE Sbjct: 23 ELYMSNNNINDNAAKKPPVKEFKRNCPAKSNKFVERELFSLMCNLNKIE 71 >AE013599-3789|AAM68296.1| 855|Drosophila melanogaster CG3182-PA, isoform A protein. Length = 855 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +1 Query: 163 EIYEPNEEIIFHEIYESG*SEYRRGIPAKPKNVVEKMLYLLQ*IL*KIE 309 E+Y N I + + E++R PAK VE+ L+ L L KIE Sbjct: 23 ELYMSNNNINDNAAKKPPVKEFKRNCPAKSNKFVERELFSLMCNLNKIE 71 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,957,083 Number of Sequences: 53049 Number of extensions: 223583 Number of successful extensions: 500 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1825511424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -