BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1083 (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 33 0.002 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 33 0.002 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 30 0.021 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 28 0.084 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 28 0.084 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 25 1.0 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 24 1.4 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 1.8 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 24 1.8 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 2.4 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 23 2.4 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 3.2 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 3.2 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 5.5 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 7.3 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 7.3 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 7.3 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 9.6 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 9.6 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 9.6 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 33.5 bits (73), Expect = 0.002 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 511 TFAYISDDNGDAVIAFSFEEKRFWRIERQI 600 TFAYI+D G A++ + F R WRI + Sbjct: 196 TFAYIADVTGFALLVYDFRNSRSWRITNNL 225 Score = 29.1 bits (62), Expect = 0.048 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = +3 Query: 255 SVIVSIPRTRPGIPFTINKMNTYNFRKNNYSPLLMPYPT-----SKESENIISVYK 407 +V V+IPR + G+P T+ + N PL+ PYP K + + SVY+ Sbjct: 72 TVFVAIPRIQDGVPLTLGYVTREVSIDGN--PLIAPYPNWSYNDVKYCDGLTSVYR 125 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 33.5 bits (73), Expect = 0.002 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +1 Query: 514 FAYISDDNGDAVIAFSFEEKRFWRI 588 FAY+SD+ G +I +S+E+ R WRI Sbjct: 206 FAYMSDELGYGLIVYSWEQNRSWRI 230 Score = 28.3 bits (60), Expect = 0.084 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 258 VIVSIPRTRPGIPFTINKMNTYNFRKNNYSPLLMPYP 368 + V++PR R GIP T+ ++ R SP L PYP Sbjct: 79 LFVTVPRWRNGIPATLTYISLDTNRGG--SPKLTPYP 113 Score = 23.0 bits (47), Expect = 3.2 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 422 CERYWFVDTGFIDV 463 C+R W +DTG I + Sbjct: 138 CDRLWVLDTGTIGI 151 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 30.3 bits (65), Expect = 0.021 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +1 Query: 511 TFAYISDDNGDAVIAFSFEEKRFWRI 588 T+AYISD +G A++ +S+ + WRI Sbjct: 187 TYAYISDLSGYALVVYSWAKNDSWRI 212 Score = 29.1 bits (62), Expect = 0.048 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = +3 Query: 174 PGRNIGRTRKVSNSK--EFGSKPRRLQL*S--VIVSIPRTRPGIPFTINKMNTYNFRKNN 341 P NI R +SN E + P +Q+ + V ++IPR + G+P + +N + + Sbjct: 32 PNDNI-RNTLISNGDYIEENNMPNGMQIWNDKVFITIPRWKNGVP---SNLNFFLKNDES 87 Query: 342 YSPLLMPYP 368 SP L PYP Sbjct: 88 ESPKLNPYP 96 Score = 25.0 bits (52), Expect = 0.78 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 422 CERYWFVDTGFIDVPG 469 C+R W VDTG D+ G Sbjct: 120 CDRLWGVDTGVDDILG 135 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 28.3 bits (60), Expect = 0.084 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 511 TFAYISDDNGDAVIAFSFEEKRFWRIERQITGSEL 615 T YI+DD GDA+I + + F R+ + ++L Sbjct: 202 TTVYIADDRGDALIIYQNSDDSFHRLTSKTFDNDL 236 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 28.3 bits (60), Expect = 0.084 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 511 TFAYISDDNGDAVIAFSFEEKRFWRI 588 T Y++DD GDA+I + ++ F R+ Sbjct: 202 TIVYMADDKGDALIVYQNSDESFHRL 227 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 24.6 bits (51), Expect = 1.0 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Frame = +3 Query: 288 GIPFTINKMNTYNFRKNNYSPLLMPYP--TSKESEN---IISVYK 407 G+P ++N + + N PLL PYP T ++EN I S YK Sbjct: 83 GVPSSLNVITN---KTGNGGPLLAPYPDWTWAKNENCSGITSAYK 124 Score = 21.8 bits (44), Expect = 7.3 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +2 Query: 422 CERYWFVDTGFID 460 C+R W +D+G I+ Sbjct: 130 CDRLWVLDSGLIN 142 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 317 IHLVDCEWYTWPRPRNRYYY 258 +HL+D WY +P P N ++ Sbjct: 34 LHLIDANWYQYP-PLNPMWH 52 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.8 bits (49), Expect = 1.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +2 Query: 422 CERYWFVDTGFIDV 463 C+R W +D+G +D+ Sbjct: 256 CDRLWILDSGKVDI 269 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.8 bits (49), Expect = 1.8 Identities = 20/71 (28%), Positives = 30/71 (42%) Frame = +2 Query: 425 ERYWFVDTGFIDVPGLRSLTIDYIFPCNKPSRTSVTITVTLSLPFRLRKNVSGGSNVKSL 604 ERY + +I G R ID + CNK + + + V ++ R + G N + Sbjct: 78 ERYQPISYKWITRSGTREQFIDMVARCNK-AGVRIYVDVIMNHMSGDRNDAHGTGNSR-- 134 Query: 605 EANLGTFPIPQ 637 AN F PQ Sbjct: 135 -ANTYNFDYPQ 144 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 23.4 bits (48), Expect = 2.4 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 264 VSIPRTRPGIPFTINKMNTYNFRKNNYSPLLMPYP 368 V+I R G+P ++N + +K PLL PYP Sbjct: 84 VTIERNN-GVPSSLNVVTN---KKGKGGPLLRPYP 114 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 314 HLVDCEWYTWPRPRNRYYY 258 HL+D WY +P P N ++ Sbjct: 1 HLIDANWYQYP-PLNPMWH 18 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 23.0 bits (47), Expect = 3.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 306 NKMNTYNFRKNNYS 347 N N YN+ NNY+ Sbjct: 99 NNYNNYNYNNNNYN 112 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.0 bits (47), Expect = 3.2 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Frame = +3 Query: 288 GIPFTINKMNTYNFRKNNYSPLLMPYPTSKESEN-----IISVYK 407 G+P ++N ++ + N PLL PYP ++N I SVY+ Sbjct: 86 GVPSSLNVISN---KIGNGGPLLEPYPNWSWAKNQNCSGITSVYR 127 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +3 Query: 297 FTINKMNTYNFRKNNYSPLL 356 + N N YN+ NNY+ L Sbjct: 96 YKYNYNNKYNYNNNNYNKKL 115 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 315 NTYNFRKNNYSPL 353 N YN+ NNY L Sbjct: 87 NNYNYNNNNYKKL 99 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 315 NTYNFRKNNYSPL 353 N YN+ NNY L Sbjct: 87 NNYNYNNNNYKKL 99 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 315 NTYNFRKNNYSPL 353 N YN+ NNY L Sbjct: 87 NNYNYNNNNYKKL 99 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 9.6 Identities = 5/13 (38%), Positives = 10/13 (76%) Frame = +2 Query: 422 CERYWFVDTGFID 460 C+R W +D+G ++ Sbjct: 132 CDRLWVLDSGLVN 144 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 9.6 Identities = 5/13 (38%), Positives = 10/13 (76%) Frame = +2 Query: 422 CERYWFVDTGFID 460 C+R W +D+G ++ Sbjct: 132 CDRLWVLDSGLVN 144 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 9.6 Identities = 5/13 (38%), Positives = 10/13 (76%) Frame = +2 Query: 422 CERYWFVDTGFID 460 C+R W +D+G ++ Sbjct: 132 CDRLWVLDSGLVN 144 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,924 Number of Sequences: 438 Number of extensions: 5372 Number of successful extensions: 41 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -