BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1083 (775 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00190.1 68417.m00020 pectinesterase family protein contains ... 31 1.1 At3g07870.1 68416.m00962 F-box family protein contains F-box dom... 29 3.4 At5g56800.1 68418.m07088 hypothetical protein 28 7.9 At4g37100.1 68417.m05255 hypothetical protein 28 7.9 At3g06560.1 68416.m00762 poly (A) polymerase family protein simi... 28 7.9 At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transfera... 28 7.9 >At4g00190.1 68417.m00020 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 474 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 402 YKTVEEAVKGTGSSIRGS*MYLV 470 YKT++EAV G G ++GS Y++ Sbjct: 175 YKTIQEAVNGAGERLKGSPRYVI 197 >At3g07870.1 68416.m00962 F-box family protein contains F-box domain Pfam:PF00646 Length = 417 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +1 Query: 268 LFRGRGQVYHSQSTR*ILTTSVKTITVHYSCLILRRKNQKTLYRSTK 408 ++RGRG++ + QS ILT S KT S L + K + RS++ Sbjct: 194 IYRGRGRIQYKQSEVQILTLSSKTTDQSLSWRSLGKAPYKFVKRSSE 240 >At5g56800.1 68418.m07088 hypothetical protein Length = 344 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +2 Query: 455 IDVPGLRSLTIDYIFPCNKPS 517 I+VP LRSL+IDY + ++P+ Sbjct: 123 INVPSLRSLSIDYSWAVSRPA 143 >At4g37100.1 68417.m05255 hypothetical protein Length = 896 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +3 Query: 141 RLRTQKWFNLIPGRNIGRTRKVSNSKEFGSKPRRLQL*SVIVSIPRTRPG 290 R T+ F L+ GR+ GR+R + E SK RR+ VS PG Sbjct: 624 RRETEGEFRLLGGRDGGRSRLLGVEDEHPSKGRRVSFNMERVSHSIVEPG 673 >At3g06560.1 68416.m00762 poly (A) polymerase family protein similar to SP|Q9BWT3 Poly(A) polymerase gamma (EC 2.7.7.19) (PAP gamma) (Polynucleotide adenylyltransferase gamma) (SRP RNA 3' adenylating enzyme) {Homo sapiens}; contains Pfam profiles PF04926: Poly(A) polymerase predicted RNA binding domain, PF04928: Poly(A) polymerase central domain Length = 483 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 431 YWFVDTGFIDVPGLRSLTIDYIFPCNKPS-RTSV-TITVTLSLPFRLRKNVSGGSNVKS 601 YW + I+V + S+ ID++ N S R +V I +TL +L KN GSN +S Sbjct: 377 YWGLQLRTINVSDIESVKIDFLKNVNSGSFRGTVGRIQLTLVKASQLPKNGECGSNNRS 435 >At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum] GI:7385017; contains Pfam profiles PF00201: UDP-glucoronosyl and UDP-glucosyl transferase, PF01535: PPR repeat Length = 1184 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +1 Query: 103 GYDIDGVIYTTDSDYEHKNGSILFRDEILEEHEKFLIQKNLVPNHVAFN 249 G + D V YTT D K+G + EIL+E ++ K L P V FN Sbjct: 964 GLNADTVTYTTLMDAYCKSGEMDKAQEILKE----MLGKGLQPTIVTFN 1008 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,852,115 Number of Sequences: 28952 Number of extensions: 372624 Number of successful extensions: 1001 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1000 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -