BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1078 (782 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 4.2 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 4.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.6 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 7.4 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 9.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.8 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 4.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 115 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 213 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 4.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 115 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 213 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 350 RTESCRSRTKRNRHD 306 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 350 RTESCRSRTKRNRHD 306 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 350 RTESCRSRTKRNRHD 306 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 350 RTESCRSRTKRNRHD 306 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 350 RTESCRSRTKRNRHD 306 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 350 RTESCRSRTKRNRHD 306 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 350 RTESCRSRTKRNRHD 306 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 7.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 758 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 648 +D R SP TP+ + Y +E+ + S F D+P Sbjct: 21 NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 528 HSYSRRFPR 502 H YSR+FPR Sbjct: 329 HDYSRQFPR 337 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 725 ATPLMSPYNARLESSSTGSSFP 660 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,140 Number of Sequences: 438 Number of extensions: 5091 Number of successful extensions: 22 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -