BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1077 (756 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) 38 0.012 SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) 32 0.44 SB_2655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) 28 9.4 >SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) Length = 308 Score = 37.5 bits (83), Expect = 0.012 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = +3 Query: 39 CEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 134 C+++A++ + +MPTF F KN K+DE GA+ Sbjct: 69 CQELAAKQGVTAMPTFQFFKNKVKVDEVRGAD 100 >SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) Length = 456 Score = 32.3 bits (70), Expect = 0.44 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 36 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 134 +C+ A I +MPTF F N K+DE GA+ Sbjct: 69 QCQLTAESCGIRAMPTFHFYHNKAKIDELRGAD 101 >SB_2655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = +3 Query: 45 DIASEYNINSMPTFVFVKNGKKLDEFSG 128 ++A + +N++PT + +K GK +++F G Sbjct: 36 ELAFNFGVNAVPTVIGMKGGKVINKFEG 63 >SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27) Length = 472 Score = 27.9 bits (59), Expect = 9.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 57 EYNINSMPTFVFVKNGKKLDEFSGAN 134 +YN+ +PT +GK ++EF G N Sbjct: 208 KYNVKFLPTIYLFHDGKFVEEFEGNN 233 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,787,245 Number of Sequences: 59808 Number of extensions: 396236 Number of successful extensions: 794 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 794 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -