BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1076 (781 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0971 + 8169197-8169311,8170351-8170458,8170533-8170725,817... 81 1e-15 03_06_0563 - 34738732-34738890,34738965-34739009,34739154-347392... 76 3e-14 01_06_1654 - 38924090-38924101,38924183-38924215,38924737-389248... 69 3e-12 05_06_0014 + 24854462-24854570,24854958-24855065,24855240-248554... 67 2e-11 04_03_0812 - 19922208-19922357,19922448-19922564,19922681-199227... 50 3e-06 08_02_1590 + 28074137-28074247,28074791-28074886,28074976-280750... 42 4e-04 03_02_0025 + 5084003-5084303,5084449-5084639,5084793-5084873,508... 31 0.78 01_05_0199 - 19174971-19175105,19176302-19176628,19176813-191769... 31 0.78 11_06_0061 - 19702893-19703869,19703960-19704098,19704166-197042... 31 1.4 05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093... 30 1.8 03_05_0728 - 27174157-27174408,27175316-27175364,27175454-271755... 30 1.8 01_06_0256 - 27923497-27923855,27923944-27924016,27924116-27924121 30 1.8 01_06_1656 + 38946922-38947542,38947640-38947739,38948045-389481... 29 3.1 10_08_0374 - 17312430-17312513,17312794-17313029,17313081-173132... 29 4.1 09_04_0087 + 14476539-14476675,14478876-14479635,14479720-144798... 29 4.1 12_02_0651 + 21522089-21522128,21522472-21522593,21523386-215235... 29 5.5 08_02_0584 - 19010345-19010656,19010959-19011018 29 5.5 07_01_1104 - 10160493-10160599,10160632-10160637,10160930-101609... 29 5.5 03_01_0373 - 2904914-2904949,2905030-2905144,2906446-2906534,290... 29 5.5 01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430... 29 5.5 08_01_0036 - 267236-268165,268255-268299,268485-268574,269485-26... 28 7.2 07_03_0011 + 12370624-12370684,12372573-12372718,12372793-123731... 28 7.2 04_04_0871 + 28898262-28898534,28899552-28900015,28900242-289003... 28 7.2 02_03_0382 + 18352508-18352841,18353817-18354028,18354190-183542... 28 7.2 02_02_0321 - 8934512-8935504,8935581-8935715,8935831-8936217 28 7.2 10_05_0046 + 8516043-8516425,8517908-8518019,8518276-8518377,851... 28 9.6 08_02_1473 - 27358162-27358275,27358968-27359024,27359102-273592... 28 9.6 02_05_0602 + 30283893-30284170,30286259-30286305,30286534-302875... 28 9.6 >07_01_0971 + 8169197-8169311,8170351-8170458,8170533-8170725, 8170811-8171069,8171151-8171207,8171433-8171480, 8171571-8171657,8171743-8171800,8171891-8171958, 8172066-8172161,8172244-8172291,8172658-8172696, 8172782-8172868,8173136-8173147 Length = 424 Score = 80.6 bits (190), Expect = 1e-15 Identities = 40/85 (47%), Positives = 56/85 (65%), Gaps = 1/85 (1%) Frame = +3 Query: 6 WVHPEIDNPEYTPDSNLYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKE-RGEVIK 182 W P IDNP++ D +Y D + +G++LWQVKSGT+FD+FLITDDP AK E Sbjct: 300 WKAPMIDNPDFKDDPYIYAFDSLKYIGIELWQVKSGTLFDNFLITDDPELAKTFAEETWG 359 Query: 183 KRQEGEKKMKSEQDEAEREKEKAES 257 K ++ E K+ DEAE++KE+ E+ Sbjct: 360 KHKDAE---KAAFDEAEKKKEEEEA 381 >03_06_0563 - 34738732-34738890,34738965-34739009,34739154-34739201, 34739291-34739386,34739467-34739534,34739633-34739690, 34739783-34739869,34740004-34740051,34740360-34740416, 34740525-34740783,34740877-34741102,34741168-34741275, 34741885-34741987 Length = 453 Score = 76.2 bits (179), Expect = 3e-14 Identities = 37/85 (43%), Positives = 51/85 (60%), Gaps = 1/85 (1%) Frame = +3 Query: 6 WVHPEIDNPEYTPDSNLYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKE-RGEVIK 182 W P I NP+Y D +Y D + +G++LWQVKSGT+FD+ LITDDP AK+ E Sbjct: 307 WKAPLIPNPDYKDDPYIYAFDSLNHIGIELWQVKSGTLFDNILITDDPEYAKKFAEETWA 366 Query: 183 KRQEGEKKMKSEQDEAEREKEKAES 257 K ++ EK E ++ E+E A S Sbjct: 367 KHKDAEKAAFDEAEKKRLEEESANS 391 >01_06_1654 - 38924090-38924101,38924183-38924215,38924737-38924829, 38924909-38924965,38925048-38925143,38925237-38925304, 38925429-38925486,38925572-38925658,38925935-38925982, 38926060-38926116,38926200-38926458,38926666-38926858, 38926991-38927098,38927849-38927957 Length = 425 Score = 69.3 bits (162), Expect = 3e-12 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 10/93 (10%) Frame = +3 Query: 6 WVHPEIDNPEYTPDSNLYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKERGEVI-- 179 W P IDNPE+ D +LY + +G+++WQVK+G++FD+ LI DDP A++ E Sbjct: 298 WKIPWIDNPEFEDDPDLYVLKPLKYIGIEVWQVKAGSVFDNILICDDPEYARKAAEETWG 357 Query: 180 -------KKRQEGEKKMKSEQD-EAEREKEKAE 254 + +E EK+ K+ +D EAER +E+ E Sbjct: 358 ANREAEKEAFEEAEKERKAREDKEAERAREEGE 390 >05_06_0014 + 24854462-24854570,24854958-24855065,24855240-24855432, 24855892-24856150,24856236-24856292,24856370-24856417, 24856725-24856811,24856885-24856942,24857084-24857151, 24857279-24857374,24857483-24857539,24857906-24857952, 24858184-24858210,24858312-24858504 Length = 468 Score = 66.9 bits (156), Expect = 2e-11 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = +3 Query: 6 WVHPEIDNPEYTPDSNLYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKE-RGEVIK 182 W P IDNPE+ D +LY + VG+++WQVK+G++FD+ LI DDP A+ EV Sbjct: 298 WKIPWIDNPEFEDDPDLYVLKPLQYVGIEVWQVKAGSVFDNILICDDPEYARSVVDEVRA 357 Query: 183 KRQEGEKKMKSEQDEAEREKE 245 +E EK+ E ++ + +E Sbjct: 358 ANKEAEKEAFEEAEKRRKARE 378 >04_03_0812 - 19922208-19922357,19922448-19922564,19922681-19922752, 19922864-19923993,19924939-19925008,19925125-19925199 Length = 537 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/76 (31%), Positives = 45/76 (59%) Frame = +3 Query: 6 WVHPEIDNPEYTPDSNLYKRDEICAVGLDLWQVKSGTIFDDFLITDDPAAAKERGEVIKK 185 W EI NPEY + + D I A+G+++W ++ G +FD+ LI DD A +++K Sbjct: 340 WKPQEIPNPEYF-ELDKPDSDPIAAIGIEIWTMQDGILFDNILIADDEKVAT---SILEK 395 Query: 186 RQEGEKKMKSEQDEAE 233 + + +++ E+++AE Sbjct: 396 SWKPKYEVEKEKEKAE 411 >08_02_1590 + 28074137-28074247,28074791-28074886,28074976-28075023, 28075278-28075430 Length = 135 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 9/61 (14%) Frame = +3 Query: 99 QVKSGTIFDDFLITDDPAAAKERGEVIKKR---------QEGEKKMKSEQDEAEREKEKA 251 +VKSGT+FD+ LITDDP AK+ E + E EK+ E DE E + +KA Sbjct: 37 RVKSGTLFDNILITDDPEYAKKFAEETWAKHKDAEKTAFDEAEKRRLEEDDEDEADDDKA 96 Query: 252 E 254 + Sbjct: 97 D 97 >03_02_0025 + 5084003-5084303,5084449-5084639,5084793-5084873, 5084972-5085319,5085409-5086293 Length = 601 Score = 31.5 bits (68), Expect = 0.78 Identities = 12/32 (37%), Positives = 23/32 (71%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 +E+ E ++RQE E+K + E+++ RE+E+ E Sbjct: 491 REKEEEERRRQEEERKRREEEEKERREREEEE 522 Score = 28.7 bits (61), Expect = 5.5 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 + + E K+R+E EK+ + ++E R++EK E Sbjct: 499 RRQEEERKRREEEEKERREREEEERRQREKEE 530 >01_05_0199 - 19174971-19175105,19176302-19176628,19176813-19176915, 19178852-19178916,19179941-19180048,19180213-19180305, 19180395-19180442,19180801-19180899,19180980-19181096, 19181186-19181239,19181312-19181404,19181776-19181881, 19182050-19182084,19182173-19182259,19182385-19182462, 19182528-19182596,19182682-19182780,19183644-19183685, 19184498-19184570,19184654-19184982,19185070-19185127, 19185217-19185269,19186075-19186144,19186276-19186337, 19186452-19186540,19186906-19187011,19187110-19187178, 19187295-19187330 Length = 900 Score = 31.5 bits (68), Expect = 0.78 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = +3 Query: 24 DNPEYTP-DSNLYKRD--EICAVGLDLWQVKSGTIFDDFLITDDPAAAKERGEVIKKRQE 194 D+ EY DS Y R+ E C V L + + + ++ A KE+ K+R++ Sbjct: 708 DSQEYKALDSETYSRELFEECVVHL------KERLKEKERLREEEKARKEKEREEKERRK 761 Query: 195 GEKKMKSEQDEAEREKEK 248 ++K + E+ E ER+KEK Sbjct: 762 EKEKKEKERKEKERDKEK 779 >11_06_0061 - 19702893-19703869,19703960-19704098,19704166-19704287, 19704362-19704416,19704508-19704624,19704718-19705413, 19706358-19706393,19707190-19708236 Length = 1062 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +3 Query: 123 DDFLITDDPAAAKERGEVIKKRQEGEKKMKSEQDE-AEREKEKAES 257 D L +D A AK E+ K R +G+K K ++DE AE + KAE+ Sbjct: 987 DALLDENDSAIAKLEQELGKLRWKGQKMSKKKEDEDAELSRLKAEN 1032 >05_07_0329 - 29308867-29308932,29309040-29309159,29309245-29309364, 29309566-29310123,29310199-29310258,29310839-29310904, 29310993-29311103,29311167-29311257,29311349-29311449, 29311534-29311641,29311737-29314205 Length = 1289 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/36 (41%), Positives = 27/36 (75%) Frame = +3 Query: 144 DPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKA 251 + AAAK++ + KK +E EKK +++ +A++E+EKA Sbjct: 375 ESAAAKKKKK--KKEKEKEKKAAAKEADAKKEEEKA 408 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 KE E +KK +E K ++++ + EREKEK Sbjct: 452 KEEEERLKKEEEERKAEEAKRRKKEREKEK 481 >03_05_0728 - 27174157-27174408,27175316-27175364,27175454-27175536, 27175673-27175753,27175838-27175894,27176103-27176202, 27176280-27176350,27176427-27176567,27176657-27176863, 27177442-27177612,27177735-27177815,27177887-27177940, 27178040-27178154,27178302-27178441,27178976-27179197, 27179278-27179376,27179461-27179580,27179776-27179981, 27180072-27180249,27180426-27180486,27180587-27180696, 27180765-27180896,27181124-27181165,27181592-27181762, 27181806-27181808,27181848-27181974,27182130-27182164, 27182982-27183083,27183167-27183224,27183314-27183415, 27183513-27183659,27183744-27183880,27183973-27184122, 27184234-27184393,27184930-27185075,27185162-27185305, 27185535-27185663,27186376-27186420,27187103-27187192, 27187473-27187475 Length = 1506 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 153 AAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAESL 260 A + E+IKK + EKK++ QD +R +EKA ++ Sbjct: 993 AERRNEELIKKFEGAEKKIEQLQDTVQRLEEKATNM 1028 >01_06_0256 - 27923497-27923855,27923944-27924016,27924116-27924121 Length = 145 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +3 Query: 105 KSGTIFDDFLITDDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 + G + + ++D+ A+E+ KK+ E EKK K ++ E E +K+K Sbjct: 65 REGYMVEVMAVSDEKKEAEEK----KKKDEEEKKKKEKEKEEEEKKKK 108 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 180 KKRQEGEKKMKSEQDEAEREKEKAE 254 +K++ EKK K E+++ ++EKEK E Sbjct: 78 EKKEAEEKKKKDEEEKKKKEKEKEE 102 >01_06_1656 + 38946922-38947542,38947640-38947739,38948045-38948189, 38948868-38948991,38949443-38949960,38950111-38950458, 38950557-38950638,38951309-38951707,38951790-38951927, 38952063-38952108,38952200-38952369 Length = 896 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 153 AAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 A KE+ K+ E K+ K +Q+EAE+E+++ E Sbjct: 391 AQKEQKRREKEEAETRKQQKKQQEEAEKEQKRRE 424 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/33 (30%), Positives = 25/33 (75%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKEKAES 257 +E+ E K+Q+ +++ ++++++ REKE+AE+ Sbjct: 373 REKEEAEMKKQQRKQEEEAQKEQKRREKEEAET 405 >10_08_0374 - 17312430-17312513,17312794-17313029,17313081-17313261, 17313335-17313445,17313495-17313722,17313862-17313999, 17314159-17314375,17314452-17314564,17314919-17314921 Length = 436 Score = 29.1 bits (62), Expect = 4.1 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 4/53 (7%) Frame = +3 Query: 102 VKSGTIFDDFLITDDPAAAK----ERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 + S IF D + DDP + ER ++R+E E++ + E+ E E+EKE+ Sbjct: 316 IDSSAIFGDSSL-DDPHLERQLQEEREAREREREEREREKERERQEREQEKER 367 >09_04_0087 + 14476539-14476675,14478876-14479635,14479720-14479871, 14479958-14480024,14480632-14480831,14480915-14481068, 14481585-14481669,14481766-14481857,14482575-14482766, 14482867-14482992,14483072-14483125,14483494-14483550, 14484509-14484606,14484703-14485038,14485116-14485203, 14486891-14487016,14487082-14487138,14488054-14488133, 14488228-14488270,14488948-14489034,14489331-14489420, 14489996-14490054,14490141-14490231,14490330-14490495, 14490662-14490755,14491787-14492909 Length = 1537 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 141 DDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 D+ +++ E KK E EK+ DE E+EKEK + Sbjct: 218 DNEKEKEDKEEETKKDNEKEKEQLMGTDEKEKEKEKED 255 >12_02_0651 + 21522089-21522128,21522472-21522593,21523386-21523544, 21523653-21523730,21523821-21523865,21524121-21524187, 21524261-21524322,21524407-21524546,21524752-21524878, 21524957-21525071,21525210-21525298,21525533-21525616, 21525857-21526219,21526300-21526689,21526835-21526894, 21527530-21527553 Length = 654 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = +3 Query: 102 VKSGTIFDDFLIT---DDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAESL 260 +K + +D L T A K VI R++ E+++ +++ EAE KEK L Sbjct: 554 IKRSSALEDQLATALVSKEQAEKNLSSVINSREQLERRLANKEKEAEMLKEKIAGL 609 >08_02_0584 - 19010345-19010656,19010959-19011018 Length = 123 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 162 ERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 E +V K+ + EKK K EA+ EKEK E Sbjct: 4 EAADVAKEHHKEEKKDKEHAKEAKPEKEKKE 34 >07_01_1104 - 10160493-10160599,10160632-10160637,10160930-10160975, 10161053-10161190,10161275-10161679,10163193-10163330, 10163401-10163482,10163596-10163943,10164294-10164655, 10165154-10165209,10166428-10166558,10166564-10166628, 10169191-10169631 Length = 774 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 153 AAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 A KE +++ E +K+ K Q+E ERE+++ E Sbjct: 242 AEKEAKRAEREKAEQKKRSKKHQEEVEREQKRRE 275 >03_01_0373 - 2904914-2904949,2905030-2905144,2906446-2906534, 2906670-2906889,2907921-2907985,2908619-2908879, 2909204-2909417,2910643-2910698,2910891-2910947, 2911043-2911115,2912711-2913225 Length = 566 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 141 DDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 D+ KER + ++R +K K ++ E ERE+EK Sbjct: 102 DEKDREKERDKDKERRSRDREKEKEKEKEREREREK 137 >01_05_0487 + 22641133-22642182,22642276-22642863,22642961-22643068, 22643582-22643692,22643784-22643849,22644858-22644917, 22644990-22645119,22645159-22645547,22645783-22645902, 22645957-22646022,22646190-22646255 Length = 917 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/32 (31%), Positives = 23/32 (71%) Frame = +3 Query: 153 AAKERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 A ++ E ++KR+E +K K+E++ +RE+++ Sbjct: 181 AKRKEAEELRKREEELRKRKAEEERLQREEDE 212 >08_01_0036 - 267236-268165,268255-268299,268485-268574,269485-269805, 269895-270098,271532-271664,271810-271881,273106-273168, 273252-275034,275169-275217 Length = 1229 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 397 RTLRTPRYLMSWHSLINHNSLQLIVFLH 314 R L T +L++W + + H+SL + FLH Sbjct: 119 RLLPTASHLLAWRTALAHSSLAVCRFLH 146 >07_03_0011 + 12370624-12370684,12372573-12372718,12372793-12373129, 12374323-12374452,12375346-12375406,12375572-12375618, 12376873-12376950,12377195-12377345,12377495-12377558, 12377735-12377893,12378007-12378128,12378952-12378981, 12379050-12379124,12379563-12379644,12379809-12379938, 12381417-12382164,12382833-12383054,12383127-12383276, 12384851-12384904,12384985-12385058,12386130-12386204, 12386365-12386584 Length = 1071 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 144 DPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEK 248 D KER E ++R GE++ + E E EKEK Sbjct: 113 DKGKEKERMEEHERRPGGERERERHDQEKELEKEK 147 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +3 Query: 168 GEVIKKRQEGEKKMKSEQDEAEREKEK 248 GE ++R + EK+++ E+D AER++++ Sbjct: 130 GERERERHDQEKELEKEKDRAERDRDQ 156 >04_04_0871 + 28898262-28898534,28899552-28900015,28900242-28900356, 28900510-28901157,28901282-28901374,28901658-28901795, 28902147-28902206 Length = 596 Score = 28.3 bits (60), Expect = 7.2 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 4/73 (5%) Frame = +3 Query: 51 NLYKRDEICAVGLDLWQVKSGTIFDDFLIT-DDPAAAKERGEVIKKR---QEGEKKMKSE 218 N ++R A+ LD W + + ++ AAK+ + KK+ +E +K K+ Sbjct: 464 NTFRR--FMALNLDKWDWHAADVPSALTKEMEESQAAKQAEKDAKKKARAKELKKLKKAR 521 Query: 219 QDEAEREKEKAES 257 + E E+EKEKA++ Sbjct: 522 EKEKEKEKEKAQA 534 >02_03_0382 + 18352508-18352841,18353817-18354028,18354190-18354277, 18355017-18355474 Length = 363 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +3 Query: 141 DDPAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAES 257 DD AA E GE ++ E +++ K DE E+EKEK +S Sbjct: 269 DDKKAA-EGGE---EKDESKEEKKEGDDEKEKEKEKDDS 303 >02_02_0321 - 8934512-8935504,8935581-8935715,8935831-8936217 Length = 504 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/29 (34%), Positives = 22/29 (75%) Frame = +3 Query: 159 KERGEVIKKRQEGEKKMKSEQDEAEREKE 245 +ER EVI++++E + ++++E + +R KE Sbjct: 96 RERDEVIRRKEEEQGRLQAELKKVQRAKE 124 >10_05_0046 + 8516043-8516425,8517908-8518019,8518276-8518377, 8518605-8518657,8518976-8519062,8519162-8519830, 8520154-8520214,8520295-8520342 Length = 504 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +3 Query: 147 PAAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKAE 254 PAAA E ++ +EGE + + E+++ E E E+ + Sbjct: 16 PAAAGEEEAPVEMDEEGEMEEEEEEEQGEGEGEERD 51 >08_02_1473 - 27358162-27358275,27358968-27359024,27359102-27359245, 27359770-27359934,27360020-27360208,27360301-27360535, 27360826-27360932,27361020-27361103,27361185-27361695, 27361793-27361854,27363373-27363456 Length = 583 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 150 AAAKERGEVIKKRQEGEKKMKSEQDEAEREKEKA 251 AAA+ + K++QE E+K + + +E E E + A Sbjct: 453 AAAEREAAIAKQKQEEEEKRRKQLEEEELESKLA 486 >02_05_0602 + 30283893-30284170,30286259-30286305,30286534-30287510, 30287611-30287920,30288561-30290197 Length = 1082 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 138 TDDPAAAKERGEVIKKRQEGEKKMK 212 +DDP AA++ GEV+K ++ K +K Sbjct: 496 SDDPIAAQKAGEVLKNLEKCSKNIK 520 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,637,634 Number of Sequences: 37544 Number of extensions: 336994 Number of successful extensions: 1332 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1316 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -